User talk:LightandDark2000/Archive 4
This is an archive of past discussions about User:LightandDark2000. Do not edit the contents of this page. If you wish to start a new discussion or revive an old one, please do so on the current talk page. |
Archive 1 | Archive 2 | Archive 3 | Archive 4 | Archive 5 |
This is my fourth talk page archive. The discussions in this archive span from April 2019 to May 2021. LightandDark2000 🌀 (talk) 21:51, 4 May 2019 (UTC)
Kenneth
I hope the article is fine. I plan to add much more to the MH over the next few or several days (depending on how the track goes). I added a bunch of wikiprojects to the talk page. Please add any I may have missed. Thanks. NoahTalk 22:53, 24 April 2019 (UTC)
- That article is probably going to blow up over the next week or so (unless the storm ends up becoming a dud - which it probably won't). I wouldn't worry too much about the pace of expansion, though I would focus primarily on prose and links at the moment, mainly to improve accessibility to the article. This should improve reader experience until more information starts pouring in on the storm's impacts, which won't be long from now. LightandDark2000 🌀 (talk) 22:57, 24 April 2019 (UTC)
- Yeah... it likely will. I linked everything that should have been linked imo. I mainly discussed intensification since the storm has a relatively short history altogether as it just formed about 2 days ago and exploded upward. Overall, there really wasn't that much discussion about the structure of the storm from both JTWC and MFR due to how quickly it shot up. I have heard of two possibilities regarding its future.... either a stall over Mozambique and dissipation slightly north or a recurve to the south and east with the storm striking Madagascar. The latter calls for restrengthening after leaving the island as it turns southward. NoahTalk 23:04, 24 April 2019 (UTC)
- EDIT: Are you sure that Seychelles was impacted that badly? It was a decent distance from the track. NoahTalk 23:12, 24 April 2019 (UTC)
- It looks like the Seychelles did receive some impacts (probably from the outer rainbands) while the storm was still a tropical depression. Nonetheless, any impacts in the Seychelles is going to be minimal compared to what the Comoro Islands and Mozambique are getting. LightandDark2000 🌀 (talk) 23:14, 24 April 2019 (UTC)
- I'm just saying... Someone died from Idai on Madagascar and we considered it low importance. I would leave it as low unless the impacts actually warrant raising it. I left the others blank for now since they are likely going to be direct, severe impacts. NoahTalk 23:17, 24 April 2019 (UTC)
- Looks like Kenneth is pulling a Michael. From MFR: "GIVEN THE RECENT TREND, WITHOUT ANY DETERIORATION OF ITS ENVIRONMENT, KENNETH IS EXPECTED TO INTENSIFY UP TO THE LANDFALL. IT IS EXPECTED TO BE CLOSE TO THE VERY INTENSE TROPICAL CYCLONE STAGE AND MAY BECOME ONE." They predict 115 knots! NoahTalk 01:35, 25 April 2019 (UTC)
- I don't think that Kenneth is going to reach Category 5 intensity, especially now that it's making landfall. It does look more like Hurricane Harvey, though. I'm not all that surprised; the water temperatures in the path of the storm are pretty warm, and wind shear is absent. Kenneth is going to be another freaking disaster if it stalls. LightandDark2000 🌀 (talk) 18:13, 25 April 2019 (UTC)
- It looks like the Seychelles did receive some impacts (probably from the outer rainbands) while the storm was still a tropical depression. Nonetheless, any impacts in the Seychelles is going to be minimal compared to what the Comoro Islands and Mozambique are getting. LightandDark2000 🌀 (talk) 23:14, 24 April 2019 (UTC)
Hey... Kenneth is an overland depression. That is how the MFR categorized it, so TS does not apply. The MFR actually said it was an overland depression "Depression sur terre" when it was 85 knots. Take note this is NOT the same as tropical depression. The MFR will make any storm at any intensity an overland depression once it's inland. Also, please don't put official statuses in quotation marks. NoahTalk 10:20, 26 April 2019 (UTC)
- I understand that Kenneth is officially classified by the MRF as an overland depression. However, it is necessary to mention the equivalent intensities before the system actually weakens to tropical depression strength, so that our readers don't get confused. Nonetheless, I don't see any issues with the present revision (as of this time). LightandDark2000 🌀 (talk) 22:42, 26 April 2019 (UTC)
- Yes, that was why I had wind speeds listed in the actual prose (which someone tried to remove as "unnessecary" earlier). Also... did you see the unfortunate addition I had to make to Idai? NoahTalk 00:44, 27 April 2019 (UTC)
- I understand that Kenneth is officially classified by the MRF as an overland depression. However, it is necessary to mention the equivalent intensities before the system actually weakens to tropical depression strength, so that our readers don't get confused. Nonetheless, I don't see any issues with the present revision (as of this time). LightandDark2000 🌀 (talk) 22:42, 26 April 2019 (UTC)
Wikipedia:WikiProject Portals update #031, 01 May 2019
Back to the drawing board
Implementation of the new portal design has been culled back almost completely, and the cull is still ongoing. The cull has also affected portals that existed before the development of the automated design.
Some of the reasons for the purge are:
- Portals receive insufficient traffic, making it a waste of editor resources to maintain them, especially for narrow-scope or "micro" portals
- The default {{bpsp}} portals are redundant with the corresponding articles, being based primarily on the corresponding navigation footer displayed on each of those articles, and therefore not worth separate pages to do so
- They were mass created
Most of the deletions have been made without prejudice to recreation of curated portals, so that approval does not need to be sought at Deletion Review in those cases.
In addition to new portals being deleted, most of the portals that were converted to an automated design have been reverted.
Which puts us back to portals with manually selected content, that need to be maintained by hand, for the most part, for the time being, and back facing some of the same problems we had when we were at this crossroads before:
- Manually maintained portals are not scalable (they are labor intensive, and there aren't very many editors available to maintain them)
- The builders/maintainers tend to eventually abandon them
- Untended handcrafted portals go stale and fall into disrepair over time
These and other concepts require further discussion. See you at WT:POG.
However, after the purge/reversion is completed, some of the single-page portals might be left, due to having acceptable characteristics (their design varied some). If so, then those could possibly be used as a model to convert and/or build more, after the discussions on portal creation and design guidelines have reached a community consensus on what is and is not acceptable for a portal.
See you at WT:POG.
Curation
A major theme in the deletion discussions was the need for portals to be curated, that is, each one having a dedicated maintainer.
There are currently around 100 curated portals. Based on the predominant reasoning at MfD, it seems likely that all the other portals may be subject to deletion.
See you at WT:POG.
Traffic
An observation and argument that arose again and again during the WP:ENDPORTALS RfC and the ongoing deletion drive of {{bpsp}} default portals, was that portals simply do not get much traffic. Typically, they get a tiny fraction of what the corresponding like-titled articles get.
And while this isn't generally considered a good rationale for creation or deletion of articles, portals are not articles, and portal critics insist that traffic is a key factor in the utility of portals.
The implication is that portals won't be seen much, so wouldn't it be better to develop pages that are?
And since such development isn't limited to editing, almost anything is possible. If we can't bring readers to portals, we could bring portal features, or even better features, to the readers (i.e., to articles)...
Some potential future directions of development
Quantum portals?
An approach that has received some brainstorming is "quantum portals", meaning portals generated on-the-fly and presented directly on the view screen without any saved portal pages. This could be done by script or as a MediaWiki program feature, but would initially be done by script. The main benefits of this is that it would be opt-in (only those who wanted it would install it), and the resultant generated pages wouldn't be saved, so that there wouldn't be anything to maintain except the script itself.
Non-portal integrated components
Another approach would be to focus on implementing specific features independently, and provide them somewhere highly visible in a non-portal presentation context (that is, on a page that wasn't a portal that has lots of traffic, i.e., articles). Such as inserted directly into an article's HTML, as a pop-up there, or as a temporary page. There are scripts that use these approaches (providing unrelated features), and so these approaches have been proven to be feasible.
What kind of features could this be done with?
The various components of the automated portal design are transcluded excerpts, news, did you know, image slideshows, excerpt slideshows, and so on.
Some of the features, such as navigation footers and links to sister projects are already included on article pages. And some already have interface counterparts (such as image slideshows). Some of the rest may be able to be integrated directly via script, but may need further development before they are perfected. Fortunately, scripts are used on an opt-in basis, and therefore wouldn't affect readers-in-general and editors-at-large during the development process (except for those who wanted to be beta testers and installed the scripts).
The development of such scripts falls under the scope of the Javascript-WikiProject/Userscript-department, and will likely be listed on Wikipedia:User scripts/List when completed enough for beta-testing. Be sure to watchlist that page.
Where would that leave curated portals?
Being curated. At least for the time being.
New encyclopedia program features will likely eventually render most portals obsolete. For example, the pop-up feature of MediaWiki provides much the same functionality as excerpts in portals already, and there is also a slideshow feature to view all the images on the current page (just click on any image, and that activates the slideshow). Future features could also overlap portal features, until there is nothing that portals provide that isn't provided elsewhere or as part of Wikipedia's interface.
But, that may be a ways off. Perhaps months or years. It depends on how rapidly programmers develop them.
Keep on keepin' on
The features of Wikipedia and its articles will continue to evolve, even if Portals go by the wayside. Most, if not all of portals' functionality, or functions very similar, will likely be made available in some form or other.
And who knows what else?
No worries.
Until next issue... — The Transhumanist 01:21, 2 May 2019 (UTC)
A class review
Hey, would you be willing to review any of the articles here for A class? I hate to have to ask people, but they have been sitting there for 1-2 months. I don't know about HH, but I was planning to take some of mine to FAC eventually. NoahTalk 02:44, 9 May 2019 (UTC)
- Class Review at the Class A and higher levels are quite difficult. The standards are set very high for those articles in general. I personally haven't come across any articles that are Class A before, as far as I remember. I'm not sure if I need to start a formal review for Class A status; if so, I'm not used to performing formal class evaluations, so I may not be the best person for the job if this is the case. I can do a quick, informal review of some of those articles later this week, but I hope that I won't get reverted if I decide to upgrade their rank after performing my analysis. LightandDark2000 🌀 (talk) 18:27, 9 May 2019 (UTC)
- Basically, this is the same as a GA review, except the article is being held to the same standards as a FA. Tropical Depression Nineteen-E (2018) has an A class review on its talk page if you would like to see what an A class review might entail. NoahTalk 20:21, 9 May 2019 (UTC)
- Personally, I believe that FA status is another step higher than Class A status, despite the similarity. But thanks for the clarification. LightandDark2000 🌀 (talk) 20:23, 9 May 2019 (UTC)
- For most articles, people do intend to take them to FAC after getting a review done. The big thing is ironing out issues in the article that may have been missed in the GA review. We do have 141 A Class articles right now as a project. NoahTalk 20:34, 9 May 2019 (UTC)
- Personally, I believe that FA status is another step higher than Class A status, despite the similarity. But thanks for the clarification. LightandDark2000 🌀 (talk) 20:23, 9 May 2019 (UTC)
- Basically, this is the same as a GA review, except the article is being held to the same standards as a FA. Tropical Depression Nineteen-E (2018) has an A class review on its talk page if you would like to see what an A class review might entail. NoahTalk 20:21, 9 May 2019 (UTC)
Archived links for Ann
@LightandDark2000: I added two archived links for the sources on Ann's section in the 2018–19 Australian region cyclone season article regarding the system's dissipation on 18 May like you wanted. ChocolateTrain (talk) 07:24, 19 May 2019 (UTC)
- Wonderful! Thanks. Remember to sign your own posts new time, though. LightandDark2000 🌀 (talk) 08:37, 19 May 2019 (UTC)
Thanks
- Thanks for the kind thank you in storm for the Massive Towering Vertical shot. Since you are an astronomer, I thought you may like this shot as well:
https://commons.wikimedia.org/wiki/File:Trifecta_Morning_Mountain_Moonset_01-31-2018.jpg We have something in common: "we are always looking up" All the best, Jessie Eastland (talk) 16:33, 20 May 2019 (UTC)
- Nice picture! It looks like the Eclipse is beginning in the picture. It's a great shot. LightandDark2000 🌀 (talk) 01:05, 21 May 2019 (UTC)
- Yes, strange. At the very end of it when the moon had finally gone through the entire evening phase, as it set in the morning it looked like a colorful crescent moon, or as you said the beginning and not the end. Actually, however, as you know, when it first rose it was full, and then at almost 90 degrees, it started to shrink as the eclipse began. The colors through the entire process, which I stayed up for until it set in the morning, were incredible. Every moon I have shot setting in the morning light has faded to almost oblivion as it set. This one maintained at least 1/2 of it's mass as extremely visible as it set. Cheers Jessie Eastland (talk) 03:36, 21 May 2019 (UTC)
Re: Rolf
Before I publish it, I have issue with Rolf's MH relying so much on maps, especially saying things like "strengthening" based on an image. Can you get any better sources? Otherwise, it borders on WP:OR. The article looks decent though. I'm sure there's more impacts out there too to help flesh out the impact, but that's not required before publishing. ♫ Hurricanehink (talk) 21:33, 20 May 2019 (UTC)
- @Hurricanehink: There are the advisories from the NOAA, and the English-language version of the storm report from the FUB (both included in the draft). Though to be honest, when I began the draft, I leaned more on the surface analysis maps, and I didn't discover the FUB's report for another few years. I think I will also try to incorporate more data from the journal articles for the chunks that delve into more details on Rolf's tropical transition and strengthening trends. Perhaps I should double-cite from one of those reports for the areas currently citing only a map when the information in the said chunk may not be immediately obvious from the map. Hopefully, citing more from the advisories + storm reports should resolve the OR problems. Concerning the impacts, I'm plenty sure that there is more information out there, particularly in Italian and French. The problem is, I have a difficult time reading those sources (on the it.wiki and de.wiki), and as we know, Google Translate doesn't always work properly when translating foreign languages. LightandDark2000 🌀 (talk) 01:03, 21 May 2019 (UTC)
- Yea, if you incorporate more of the journal articles, I'm sure the article will stand up more on its own. As for Google Translate, yea it's not always the most accurate, but if you do go that route, make sure you focus on the headlines and the first paragraph. That's where most news stories have the important information. Don't worry as much about the impact, since you have a good source for the damage total, which is enough for any meteorological event to get an article. Lemme know when you add the FUB report and journal articles. That'll make the article much stronger. ♫ Hurricanehink (talk) 13:42, 21 May 2019 (UTC)
- @Hurricanehink: What do you think now? I've incorporate two more journal articles plus the FUB's report, and none of the sentences are cited solely by surface maps at this point (I kept the surface maps around for visual reference, but they are backed by other sources as well). The impacts probably need more work, but most of the information there is probably going to come from foreign language sources, which I will try to dig up at the it.wiki and de.wiki articles of Rolf. I will make a few more adjustments later to prepare for a page move. If there are no serious issues at this point, I think that I will move the draft to mainspace within a day and make some final adjustments there. LightandDark2000 🌀 (talk) 09:45, 25 May 2019 (UTC)
- My, that was fast. LightandDark2000 🌀 (talk) 23:41, 25 May 2019 (UTC)
- @Hurricanehink: What do you think now? I've incorporate two more journal articles plus the FUB's report, and none of the sentences are cited solely by surface maps at this point (I kept the surface maps around for visual reference, but they are backed by other sources as well). The impacts probably need more work, but most of the information there is probably going to come from foreign language sources, which I will try to dig up at the it.wiki and de.wiki articles of Rolf. I will make a few more adjustments later to prepare for a page move. If there are no serious issues at this point, I think that I will move the draft to mainspace within a day and make some final adjustments there. LightandDark2000 🌀 (talk) 09:45, 25 May 2019 (UTC)
- Yea, if you incorporate more of the journal articles, I'm sure the article will stand up more on its own. As for Google Translate, yea it's not always the most accurate, but if you do go that route, make sure you focus on the headlines and the first paragraph. That's where most news stories have the important information. Don't worry as much about the impact, since you have a good source for the damage total, which is enough for any meteorological event to get an article. Lemme know when you add the FUB report and journal articles. That'll make the article much stronger. ♫ Hurricanehink (talk) 13:42, 21 May 2019 (UTC)
As long as articles for the Medicanes have more info than the section in the main article, and there are a variety of independent sources establishing notability and verification, then I'm ok with the two articles you mentioned, so long as you trim down the section in the main article. Since Mediterranean tropical-like cyclone is over 100 kb, I think it would be good to be a bit shorter. As for Zorbas, you should do a broader search, not just for "Zorbas", but also "storm Greece [date]" in your searches. Keep up the good work though. I'll make sure Rolf gets a mention in the monthly newsletter. ♫ Hurricanehink (talk) 01:15, 31 May 2019 (UTC)
Thanks for the invitation!
Hey thanks for the invitation to the tropical cyclone wiki project, I appreciate it. =D -User:SaiTheCyclone (talk) 16:29, 22 May 2019 (UTC)
- You're welcome. :D LightandDark2000 🌀 (talk) 16:29, 22 May 2019 (UTC)
Question
I see you make nice userboxes, have you ever thought about making userboxes for other users on Wikipedia.Catfurball (talk) 16:31, 30 May 2019 (UTC)
- @Catfurball: Anyone can use my userboxes, as long as they accurately describe them. The reason why they are currently named under my userspace is because they are personalized to fit my own preferences (though I realize that they could describe other people as well). I haven't thought about creating more general userboxes, as it isn't something that I do very often, but I may create some in the future. LightandDark2000 🌀 (talk) 20:19, 30 May 2019 (UTC)
@LightandDark2000: The only thing you have to do is add your name to Wikipedia:Userboxes. I've got many ideas.Catfurball (talk) 20:31, 30 May 2019 (UTC)
June 2019 WPTC Newsletter
Volume XIV, Issue 39, May 31, 2019 The Hurricane Herald is the arbitrarily periodical newsletter of WikiProject Tropical Cyclones. The newsletter aims to provide in summary the recent activities and developments of the WikiProject, in addition to global tropical cyclone activity. The Hurricane Herald has been running since its first edition ran on June 4, 2006; it has been almost thirteen years since that time. If you wish to receive or discontinue subscription to this newsletter, please visit the mailing list. This issue of The Hurricane Herald covers all project related events from April 14–May 31, 2019. This edition's editor and author is Hurricane Noah (talk · contribs). Please visit this page and bookmark any suggestions of interest to you. This will help improve the newsletter and other cyclone-related articles. Past editions can be viewed here. | |||||||||||||||||||||||
Article of the month, by Jason Rees History of tropical cyclone naming - The practice of using names to identify tropical cyclones goes back several centuries, with storms named after places, saints or things they hit before the formal start of naming in each basin. The credit for the first usage of personal names for weather systems is given to the Queensland Government Meteorologist Clement Wragge, who named tropical cyclones and anticyclones between 1887 and 1907. This system of naming fell into disuse for several years after Wragge retired, until it was revived in the latter part of World War II for the Western Pacific basin. Over the following decades, various naming schemes have been introduced for the world's oceans, including for parts of the Atlantic, Pacific and the Indian Ocean. The majority of these lists are compiled by the World Meteorological Organization's tropical cyclone committee for the region and include names from different cultures as well as languages. Over the years there has been controversy over the names used at various times, with names being dropped for religious and political reasons. For example, female names were exclusively used in the basins at various times between 1945 - 2000 and were the subject of several protests. The names of significant tropical cyclones in the North Atlantic Ocean, Pacific Ocean and Australian region are retired from the naming lists and replaced with another name, at meetings of the various tropical cyclone committees. Storm of the month and other tropical activity Cyclone Fani was an extremely severe cyclonic storm that made landfall in Odisha, India on May 3. The storm achieved peak intensity as a near Category 5-equivalent cyclone with 3-minute sustained winds of 215 km/h (130 mph), 1-minute sustained winds of 250 km/h (155 mph), and a minimum central pressure of 937 hPa (mbar). Fani caused over $1.8 billion (2019 USD) in damage in India and Bangladesh and killed at least 89 people.
New WikiProject Members since the last newsletter in April 2019 More information can be found here. This list lists members who have joined/rejoined the WikiProject since the release of the last issue in April 2019. Sorted chronologically. Struckout users denote users who have left or have been banned. To our new members: welcome to the project, and happy editing! Feel free to check the to-do list at the bottom right of the newsletter for things that you might want to work on. To our veteran members: thank you for your edits and your tireless contributions! Editorial for welcoming new users, by Hurricanehink Every year, editors new and old help maintain the new season of season articles. The older users are likely used to the standards of the project, such as how to Wikilink and reference properly. Newer users might make mistakes, and they might make them over and over again if they don't know better. If anyone (who happens to read this) comes across a new user, please don't bite, because with enough pushback, they'll decide that this group of editors is too mean, and unfun. This is all a volunteer project; no one can force anyone to do anything. We're all on here because of our love of knowledge and tropical cyclones. If you find someone new, consider using the official WPTC welcome template - Wikipedia:WikiProject Tropical cyclones/Welcome. I also encourage that if you know any tropical cyclone researchers, please speak up and try recruiting them to edit. Veteran editors can't keep editing forever. Life gets busy, and the real world beckons! Member of the month (edition) – Yellow Evan Yellow Evan has been involved with WPTC since 2008. Since the last newsletter, Yellow Evan has taken 5 typhoon articles to good article status as well as created 2 more. Overall, he has created and/or significantly contributed to more than 130 good articles. Your work in the Western Pacific Basin is invaluable... Thank you for your contributions! Latest WikiProject Alerts The following are the latest article developments as updated by AAlertBot, as of the publishing of this issue. Due to the bot workings, some of these updates may seem out of place; nonetheless, they are included here. Featured article candidates
Featured list candidates
Good article nominees
Good article reassessments
Peer reviews
Requested moves
Articles to be merged
Articles to be split
Updated daily by AAlertBot — Discuss? / Report bug? / Request feature?
Click to watch (Subscribe via RSS Atom) · Find Article Alerts for other topics!
This section lists content that have become featured, articles and lists, since the past newsletter in mid-April 2019.
WikiProject Tropical Cyclones: News & Developments
New articles since the last newsletter include:
New GA's include:
Current assessment table Assessments valid as of this printing. Depending on when you may be viewing this newsletter, the table may be outdated. See here for the latest, most up to date statistics.
From the Main Page From the Main Page documents WikiProject related materials that have appeared on the main page from April 14–May 31, 2019 in chronological order. WikiProject To-Do Project Goals & Progress The following is the current progress on the three milestone goals set by the WikiProject as of this publishing. They can be found, updated, at the main WikiProject page.
|
NoahTalk 22:20, 31 May 2019 (UTC)
A barnstar for you!
The Special Barnstar | |
Thanks for helping keep Wikipedia vandal-free! I've also noticed from your user page that we have a bunch in common! andritolion (talk) 04:42, 6 June 2019 (UTC) |
- Oh, nice! Thanks. It's actually hard work, grueling at times, but I prefer defending this site over letting vandals run rampant. LightandDark2000 🌀 (talk) 04:44, 6 June 2019 (UTC)
- I agree, keeping Wikipedia clean is hard work. It's important work though, and is greatly appreciated by the community. Oh, and I hope you won't mind if I steal some userboxes, lol. andritolion (talk) 04:48, 6 June 2019 (UTC)
- Definitely not. Just so long as they can be accurate descriptions for you. Some of them are customizable (such as the vandal-count userbox). LightandDark2000 🌀 (talk) 04:49, 6 June 2019 (UTC)
- Alrightie. I've already stolen the Windows userboxes and the smoking ones. I'll tack on the Edge ones soon! (I'm on Edge Canary right now, used to use Edge Stable as my daily driver. I also am a Windows Insider and am very against the smoking among teens in the US... I mean, so many people I know do it, and they'll likely develop an addiction to that stuff! It's dangerous stuff.) andritolion (talk) 04:52, 6 June 2019 (UTC)
- Definitely not. Just so long as they can be accurate descriptions for you. Some of them are customizable (such as the vandal-count userbox). LightandDark2000 🌀 (talk) 04:49, 6 June 2019 (UTC)
- I agree, keeping Wikipedia clean is hard work. It's important work though, and is greatly appreciated by the community. Oh, and I hope you won't mind if I steal some userboxes, lol. andritolion (talk) 04:48, 6 June 2019 (UTC)
A kitten for you!
Thank you for helping keeping Wikipedia clean!
HeartGlow30797 (talk) 05:32, 6 June 2019 (UTC)
- Thanks! LightandDark2000 🌀 (talk) 05:36, 6 June 2019 (UTC)
Question
Would this be eligible for GA even though webcite is down? NoahTalk 05:47, 8 June 2019 (UTC)
- It looks good. If there are no serious citation issues right now, then I think that the article is good for a GA run. However, if WebCite is needed for referencing any key information, I would wait until WebCite resolves their issues. LightandDark2000 🌀 (talk) 05:48, 8 June 2019 (UTC)
- Well... all the WPAC MH sources are dead due to webcite being down. NoahTalk 05:59, 8 June 2019 (UTC)
A barnstar for you!
The Anti-Vandalism Barnstar | |
For your work at Catherine of Aragon. -- DannyS712 (talk) 06:01, 10 June 2019 (UTC) |
- LOL. I saw this right after I gave you a barnstar. By the way, that LTA has been doing this kind of stuff on multiple articles for months now. LightandDark2000 🌀 (talk) 06:03, 10 June 2019 (UTC)
A Barnstar for you!
The Reviewer's Barnstar | ||
This is for your valuable efforts for reviewing articles under pending changes protection. Thank you PATH SLOPU 14:28, 14 June 2019 (UTC) |
- You're welcome. Glad to help. LightandDark2000 🌀 (talk) 06:52, 15 June 2019 (UTC)
Question regarding the 2019 Atlantic hurricane season
Hi, a new user, User:xubinzeng, edited the article which included the University of Arizona (UA). Do you think this is reliable and can be kept in the article? BlackDragon222 (talk) 23:29, 16 June 2019 (UTC)
- Uh... You might want to check with some other senior editors. For me personally, yes, I believe that it can be used in the article. However, some of the other WPTC editors may disagree. LightandDark2000 🌀 (talk) 00:08, 17 June 2019 (UTC)
Can you please move "E7 Series Shinkansen" to "E7/W7 Series Shinkansen"?
I have successfully merged it, the same way as the Japanese article. 2406:3003:2004:6A0:386F:F8D8:5043:F4B1 (talk) 11:19, 26 June 2019 (UTC)
- I think that the articles on the English Wikipedia are formatted a bit differently. All of the other similar articles are titled the same way (such as E6 Series Shinkansen). Other editors may not agree if I just move it like that. If you really want these changes to be made, you should open up a discussion on the talk page of that article for more input, as this naming scheme affects an entire group of articles, not just one. LightandDark2000 🌀 (talk) 11:22, 26 June 2019 (UTC)
- You have a point, but a move might be necessary, 2406:3003:2004:6A0:386F:F8D8:5043:F4B1 (talk) 11:37, 26 June 2019 (UTC)
- Well, as I said earlier, you should start a new discussion at Talk:E7 Series Shinkansen. This is not something that I can dictate on my own, especially since multiple articles are involved. LightandDark2000 🌀 (talk) 11:39, 26 June 2019 (UTC)
- You have a point, but a move might be necessary, 2406:3003:2004:6A0:386F:F8D8:5043:F4B1 (talk) 11:37, 26 June 2019 (UTC)
Notice of edit warring noticeboard discussion
Hello. This message is being sent to inform you that there is currently a discussion involving you at Wikipedia:Administrators' noticeboard/Edit warring regarding a possible violation of Wikipedia's policy on edit warring. Thank you. Orvilletalk 23:10, 30 June 2019 (UTC)
- Note: I was not trying to edit war, nor was I trying to push a particular revision of the page. I was merely trying to stop what I saw as obvious BLP vandalism (see the linked discussion for more details). If I breached any policies in the process, I apologize in advance. LightandDark2000 🌀 (talk) 23:52, 30 June 2019 (UTC)
BLP discretionary sanctions alert
This is a standard message to notify contributors about an administrative ruling in effect. It does not imply that there are any issues with your contributions to date.
You have shown interest in living or recently deceased people, and edits relating to the subject (living or recently deceased) of such biographical articles. Due to past disruption in this topic area, a more stringent set of rules called discretionary sanctions is in effect. Any administrator may impose sanctions on editors who do not strictly follow Wikipedia's policies, or the page-specific restrictions, when making edits related to the topic.
For additional information, please see the guidance on discretionary sanctions and the Arbitration Committee's decision here. If you have any questions, or any doubts regarding what edits are appropriate, you are welcome to discuss them with me or any other editor.
NinjaRobotPirate (talk) 23:16, 30 June 2019 (UTC)
- To be honest, I really don't have an interest in articles specifically in this category. My recent spate of activity at such articles was only to revert vandalism (I normally avoid such articles otherwise). LightandDark2000 🌀 (talk) 23:17, 30 June 2019 (UTC)
Hi LightandDark2000! Thanks for reverting the disruption to Saad bin Laden. I noticed that the IP user who made the edit didn't receive any kind of note or warning after you reverted the disruption. Did you mean to leave the user a note, or did you not do so for a reason? I went ahead and left a note for you, but just wanted to message you about it in case you had a reason for not leaving one. I don't want to step on your toes or mess anything up. ;-) Let me know (ping me in your response so that I'm notified); just trying to keep an eye out for things and make sure that nothing is missed is all. :-) Cheers - ~Oshwah~(talk) (contribs) 03:06, 1 July 2019 (UTC)
Rosa
I just wanted to ask you if you think the current version of Hurricane Rosa (2018) is significantly better than this version. I am just curious as I am planning to renominate at FAC sometime in the future. NoahTalk 01:46, 2 July 2019 (UTC)
- Checking... LightandDark2000 🌀 (talk) 01:48, 2 July 2019 (UTC)
- Seems good to me. I made a few changes. I think that the article is good for a run at FA nomination, though some more (updated) information on the impacts, if available, would be quite helpful. LightandDark2000 🌀 (talk) 02:05, 2 July 2019 (UTC)
- The issue I had is the Nora thing is unsourced and I can't seem to find anything about it being the first since then. Also, I checked for available sources when I tried the first time. News coverage simply doesn't occur for storms like this after they occur. I had to heavily rely on NOAA's database for impact info in the US. NoahTalk 02:10, 2 July 2019 (UTC)
- Thanks for those sources. Just wanted to let you know I started the nomination in case you wanted to leave any comments. NoahTalk 02:54, 2 July 2019 (UTC)
- The issue I had is the Nora thing is unsourced and I can't seem to find anything about it being the first since then. Also, I checked for available sources when I tried the first time. News coverage simply doesn't occur for storms like this after they occur. I had to heavily rely on NOAA's database for impact info in the US. NoahTalk 02:10, 2 July 2019 (UTC)
- Seems good to me. I made a few changes. I think that the article is good for a run at FA nomination, though some more (updated) information on the impacts, if available, would be quite helpful. LightandDark2000 🌀 (talk) 02:05, 2 July 2019 (UTC)
Thank you for thanking my edit!
I'm new here and I've been recently patrolling the recent changes, looking for bad edits. Thanks again! :) Here's the one you thanked me on. TomSmithNP (talk) 10:59, 2 July 2019 (UTC)
- Great job! I hope you enjoy editing here. LightandDark2000 🌀 (talk) 11:00, 2 July 2019 (UTC)
Wikipedia:CIVILWAR listed at Redirects for discussion
An editor has asked for a discussion to address the redirect Wikipedia:CIVILWAR. Since you had some involvement with the Wikipedia:CIVILWAR redirect, you might want to participate in the redirect discussion if you wish to do so. Ivanvector (Talk/Edits) 15:39, 9 July 2019 (UTC)
Research Interview Request
Greetings LightandDark2000
I am part of a research project at the University of Westminster, London, that looks at contentious Wikipedia articles and would like to interview you about your work and the issues and intricacies within collaboration practices in article development.
We have observed that you are an active editor in the Wikipedia community and that you have contributed in an article of our interest for several years (War in Donbass 2015-2018 period). This experience is of great interest to us. If you would be interested in participating in this research or would like more information, please do not hesitate to contact me through the Wikipedia mailbox or my personal talkpage. It would be a great help.
Best regards, Etchubykalo doctoral researcher at the communication and media research institute (CAMRI), University of Westminster, London.Etchubykalo (talk) 09:44, 3 July 2019 (UTC) Etchubykalo (talk) 10:05, 3 July 2019 (UTC)
Category:Politics user templates has been nominated for discussion
Category:Politics user templates, which you created, has been nominated for possible deletion, merging, or renaming. A discussion is taking place to decide whether this proposal complies with the categorization guidelines. If you would like to participate in the discussion, you are invited to add your comments at the category's entry on the categories for discussion page. Thank you. —andrybak (talk) 12:27, 14 July 2019 (UTC)
Former Hurricane Barry
Hello LightandDark2000, I do not know what happens in the future, but was the whole system of cyclone Barry really weak after the landfall yesterday? Barry lost her hurricane status, ok, making landfall with the northern parts of the system and that part may disappear slowly to the North, but in the whole area including the rainband in the Gulf of Mexico (marine warning there) Barry continued to be a severe storm, that I tried to express with my edit. It is difficult for me to write all the facts, but it seemed important for me to notice in the article that the threads and the power of the storm had not disappeared: The whirlpool area with 3 or 4 "hot spots" near the Galvestone Bay in the warm waters of the Gulf of Mexico] (circulating supercells?) that feeds the cyclone in the North is not described in the article (heavy rainfall in the East of the center). And yesterday it was not clear to me, whether the cyclone turns around to the West and in the direction of Houston and the warm water of the Gulf, so I tried to tell this our readers. If you look here, Barry turns around today. Are the thunderstormlike red hot spots near Galvestone (and the blue edge moves around ...) still part of a huge circling Barry, or is this a "new" cyclone developing there in the Gulf of Mexico, driven by the former hurricane Barry? Is it allowed to use the NOAA-animations or a satellite photo of the rainband in the article? You are able to describe that images and the context in the article, I am not good enough to to that. Thanks, --LudwigSebastianMicheler (talk) 19:13, 14 July 2019 (UTC)
- I have responded on your talk page. LightandDark2000 🌀 (talk) 00:10, 15 July 2019 (UTC)
AIV report
This report didn't make a lot of sense to me, but I blocked the user anyway. Drmies (talk) 01:06, 15 July 2019 (UTC)
- @Drmies: From what I could tell, they were making an indirect request for someone to contact them for legal reasons (likely pertaining to a potential lawsuit), so I assumed that it was some form of legal threat. In any case, they definitely weren't here to contribute. LightandDark2000 🌀 (talk) 01:08, 15 July 2019 (UTC)
Infobox television season and Yu-Gi-Oh! Duel Monsters
Regarding the use of {{Infobox television season}} on non-season articles. If you look at your recent edits at List of Yu-Gi-Oh! Duel Monsters episodes (season 1) there are some issues. First, the page is incorrectly named per WP:NCTV#Season articles and the first sentence of the lead. So per the naming convention guideline, the name would be Yu-Gi-Oh! Duel Monsters (season 1). Second issue is the infobox title you used. You are abusing the parameter, which is part of the reason why I removed it in the first place. From the little I can gather from the article (as those names aren't explained anywhere), I understand that those names are the titles of the 3 story-arcs of the season. Those do not belong in the infobox at all. See Agents of S.H.I.E.L.D. (season 4) which has 3 story arcs for that season: "Ghost Rider", "LMD" and "Agents of Hydra". Also, lists should never use the br tag as that doesn't follow WP:ACCESSABILITY. If all of those issues would be fixed, the infobox would not have needed to use the custom parameter. --Gonnym (talk) 16:26, 15 July 2019 (UTC)
- Those articles are all meant to be season articles (though I suspect that some of them have redirect links blocking a page move). By the way, since those seasons were officially named by the media company responsible for their distribution, they should be included. It would be another form of WP:COMMONNAME. LightandDark2000 🌀 (talk) 16:27, 15 July 2019 (UTC)
- How does 1 season have 3 English official names? --Gonnym (talk) 16:33, 15 July 2019 (UTC)
- Actually, it only has one official name, but it includes 2 or 3 smaller story arcs near the end that have different names. I know for certain, though, that Yu-Gi-Oh! Duel Monsters Seasons 3 and 5 have two and three official names, respectively. LightandDark2000 🌀 (talk) 16:34, 15 July 2019 (UTC)
- So again, story arcs do not belong in the infobox at all. Looking at the official site it just calls it "season 1" and even looking at a fan wiki they say they are story arcs. So for the first season, those names are incorrectly used and misleading. Even the names for season 3 are story arcs per the fan site. That the problem with not using references. You can verify claims (in this case, names of seasons used in the infobox, which in this case, turned out to be wrong). The infobox only uses official names, however if for some reason a season is known by more than 1 official name, then maybe
|also_known_as=
can be added to display that. But again, those names need to be official and not fan made, which these seem to be. --Gonnym (talk) 16:41, 15 July 2019 (UTC)- The names for Season 3, etc. (minus the last two for Season 1) are all official. They were all printed in the opening credits on DVD releases and/or live broadcasts. I've removed the non-official arc titles. BTW, I need someone to take over and rename the season articles for the other anime series, because renaming them all is much too time-consuming for me to undertake. LightandDark2000 🌀 (talk) 16:46, 15 July 2019 (UTC)
- So again, story arcs do not belong in the infobox at all. Looking at the official site it just calls it "season 1" and even looking at a fan wiki they say they are story arcs. So for the first season, those names are incorrectly used and misleading. Even the names for season 3 are story arcs per the fan site. That the problem with not using references. You can verify claims (in this case, names of seasons used in the infobox, which in this case, turned out to be wrong). The infobox only uses official names, however if for some reason a season is known by more than 1 official name, then maybe
- Actually, it only has one official name, but it includes 2 or 3 smaller story arcs near the end that have different names. I know for certain, though, that Yu-Gi-Oh! Duel Monsters Seasons 3 and 5 have two and three official names, respectively. LightandDark2000 🌀 (talk) 16:34, 15 July 2019 (UTC)
- How does 1 season have 3 English official names? --Gonnym (talk) 16:33, 15 July 2019 (UTC)
As I had suspected, at least a handful of those articles already have blocking redirects at the proper title, so I can't carry out the page-moves for some of those articles. This means that those articles will have to go through an official RfC for mass-renaming and/or have an admin carry out the moves, because they are currently beyond my technical abilities. LightandDark2000 🌀 (talk) 16:50, 15 July 2019 (UTC)
Quick question
Hey! May I ask why you requested a range block for 2401:4900:2306:CA6C:0:0:0:0/64
when all edits came from the same IP (2401:4900:2306:ca6c:9c2a:4446:320f:94e2)? --MrClog (talk) 09:01, 20 July 2019 (UTC)
- For IPv6 ranges, unless the network is shared, /64 ranges are usually allocated to just a single individual (similar to a single IPv4 IP). Since that person was likely engaging in block evasion, and since I didn't see any issues on the larger range (at the /48 level), I decided to report the /64, just in case they decide to evade their block. LightandDark2000 🌀 (talk) 09:03, 20 July 2019 (UTC)
Thank you!
Hello and thank you for helping me getting started in the WikiProject Tropical Cyclones. I earned a lot of infos from your message to me. Also thanks for sending the message “Getting Started”. I actually don’t need that message because I was editing as an anonymous user since 2012 so I alrendy know a lot about Wikipedia. Anyways thanks!
$$ Message from:DavidTheMeteorologist🌦 To: LightandDark2000 🌀 (talk) 04:32 p.m., 22 July 2019(EDT) — Preceding 20:48, 22 July 2019 (UTC) comment added by DavidTheMeteorologist🌦]] (talk • contribs) 20:36, 22 July 2019 (UTC)
Thanks
Hi LightandDark2000, Many thanks for getting the IP blocked (and thanks Favonian for doing the honours),
I had been keeping an eye on their (prev) IP address but ofcourse they're not as stupid as they look! ,
Anyway thanks both for your help :). –Davey2010Talk 17:12, 12 August 2019 (UTC)
- No problem! :D I was just doing my part to keep this site clean. LightandDark2000 🌀 (talk) 18:18, 12 August 2019 (UTC)
Backlog Banzai
In the month of September, Wikiproject Military history is running a project-wide edit-a-thon, Backlog Banzai. There are heaps of different areas you can work on, for which you claim points, and at the end of the month all sorts of whiz-bang awards will be handed out. Every player wins a prize! There is even a bit of friendly competition built in for those that like that sort of thing. Sign up now at Wikipedia:WikiProject Military history/September 2019 Backlog Banzai to take part. For the coordinators, Peacemaker67 (click to talk to me) 08:18, 22 August 2019 (UTC)
Wikiproject Military history coordinator election nominations open
Nominations for the upcoming project coordinator election are now open. A team of up to ten coordinators will be elected for the next year. The project coordinators are the designated points of contact for issues concerning the project, and are responsible for maintaining our internal structure and processes. They do not, however, have any authority over article content or editor conduct, or any other special powers. More information on being a coordinator is available here. If you are interested in running, please sign up here by 23:59 UTC on 14 September! Voting doesn't commence until 15 September. If you have any questions, you can contact any member of the coord team. Cheers, Peacemaker67 (click to talk to me) 02:38, 1 September 2019 (UTC)
ITN recognition for Hurricane Dorian
On 1 September 2019, In the news was updated with an item that involved the article Hurricane Dorian, which you updated. If you know of another recently created or updated article suitable for inclusion in ITN, please suggest it on the candidates page. LightandDark2000 🌀 (talk) 14:27, 22 December 2020 (UTC)
MH article
Hey, just wanted to see what you think about Draft:Meteorological history of Hurricane Dorian thus far. KN and I plan to publish it once the storm dissipates. NoahTalk 03:40, 5 September 2019 (UTC)
- It could probably use some improvements (though since the article is new, I don't think that this would present any significant barriers). I would just suggest that before you publish it, the article should contain substantially more information than the MH section in the main article. It's pretty good overall. LightandDark2000 🌀 (talk) 03:42, 5 September 2019 (UTC)
- I don't know for sure, but I think KN may have a hard time with the stalling section since not much happened meteorologically. I wonder if anyone recorded open water wave heights. NoahTalk 11:46, 5 September 2019 (UTC)
- I don't have anything on water wave heights. I would refer you to the NHC's logs, or maybe search through the sites of some reliable bloggers, if you can't find the info in any web articles. As for the stalling portion, I just plunked in a good chunk on that part of the storm's history in Dorian's article, so maybe I could copy that over later. LightandDark2000 🌀 (talk) 11:48, 5 September 2019 (UTC)
- I don't know for sure, but I think KN may have a hard time with the stalling section since not much happened meteorologically. I wonder if anyone recorded open water wave heights. NoahTalk 11:46, 5 September 2019 (UTC)
An award for you!
CVU Anti-Vandalism Award | ||
This is for your excellent performance in saving Wikipedia from the harmful threats of vandalism. I appreciate your efforts and hardwork. You are a bold defender of Wikipedia. Thank you. PATH SLOPU 10:41, 5 September 2019 (UTC) |
- Nice! Thanks. You're doing a great job as well! LightandDark2000 🌀 (talk) 10:42, 5 September 2019 (UTC)
Because you thanked me
LightandDark2000, you thanked me for one of my recent edits, so here is a heart-felt... YOU'RE WELCOME! It's a pleasure, and I hope you have a lot of fun while you edit this inspiring encyclopedia phenomenon! DoebLoggs (talk) |
11:37, 5 September 2019 (UTC)
A barnstar for you!
The Random Acts of Kindness Barnstar | |
Thank you for thanking other users who stand against vandalism. Angus1986 (talk) 12:22, 8 September 2019 (UTC) |
- Well, what can I say? I'm just expressing my gratitude for good work. LightandDark2000 🌀 (talk) 12:25, 8 September 2019 (UTC)
AIV - no need for pings
Note there is no need to ping specific admins for AIV reports. They may not be online at the time. Any Admin on patrol will make a determination. As the AIV helper bot removes blocked users from the list, when the pinged admins get the message the report may be long gone from the list, forcing them to browse through history to figure out what it was about. Just make the report normally and it will be handled. Thanks. -- Alexf(talk) 12:38, 10 September 2019 (UTC)
- I was just trying to get the reports resolved faster, since AVI has recently been experiencing large backlog periods. I otherwise file the reports normally. LightandDark2000 🌀 (talk) 12:40, 10 September 2019 (UTC)
Community Insights Survey
Share your experience in this survey
Hi LightandDark2000/Archive 4,
The Wikimedia Foundation is asking for your feedback in a survey about your experience with Wikipedia and Wikimedia. The purpose of this survey is to learn how well the Foundation is supporting your work on wiki and how we can change or improve things in the future. The opinions you share will directly affect the current and future work of the Wikimedia Foundation.
Please take 15 to 25 minutes to give your feedback through this survey. It is available in various languages.
This survey is hosted by a third-party and governed by this privacy statement (in English).
Find more information about this project. Email us if you have any questions, or if you don't want to receive future messages about taking this survey.
Sincerely,
RMaung (WMF) 16:36, 10 September 2019 (UTC)
Dorian dissipation
Dorian is dissipated because the OPC said it is. Unless you have info from Met UK, I would suggest you revert the changes since Germany doesn’t have jurisdiction for that area. The issue here is the original circulation died a while ago. NoahTalk 19:12, 12 September 2019 (UTC)
- I never really saw the original source from the OPC. Someone needs to go to their site and retrieve the actual advisory, because it's much harder to locate archived advisories on their website than on the NHC's site. LightandDark2000 🌀 (talk) 04:54, 14 September 2019 (UTC)
Milhist coordinator election voting has commenced
G'day everyone, voting for the 2019 Wikiproject Military history coordinator tranche is now open. This is a simple approval vote; only "support" votes should be made. Project members should vote for any candidates they support by 23:59 (UTC) on 28 September 2018. Thanks, Peacemaker67 (click to talk to me) 03:37, 15 September 2019 (UTC)
Because you thanked me
LightandDark2000, you thanked me for one of my recent edits, so here is a heart-felt... YOU'RE WELCOME! It's a pleasure, and I hope you have a lot of fun while you edit this inspiring encyclopedia phenomenon! DoebLoggs (talk) |
09:52, 17 September 2019 (UTC)
Reminder: Community Insights Survey
Share your experience in this survey
Hi LightandDark2000/Archive 4,
A couple of weeks ago, we invited you to take the Community Insights Survey. It is the Wikimedia Foundation’s annual survey of our global communities. We want to learn how well we support your work on wiki. We are 10% towards our goal for participation. If you have not already taken the survey, you can help us reach our goal! Your voice matters to us.
Please take 15 to 25 minutes to give your feedback through this survey. It is available in various languages.
This survey is hosted by a third-party and governed by this privacy statement (in English).
Find more information about this project. Email us if you have any questions, or if you don't want to receive future messages about taking this survey.
Sincerely,
RMaung (WMF) 15:38, 20 September 2019 (UTC)
Wikiproject Military history coordinator election half-way mark
G'day everyone, the voting for the XIX Coordinator Tranche is at the halfway mark. The candidates have answered various questions, and you can check them out to see why they are running and decide whether you support them. Project members should vote for any candidates they support by 23:59 (UTC) on 28 September 2018. Thanks, Peacemaker67 (click to talk to me) 07:36, 22 September 2019 (UTC)
Reminder: Community Insights Survey
Share your experience in this survey
Hi LightandDark2000/Archive 4,
There are only a few weeks left to take the Community Insights Survey! We are 30% towards our goal for participation. If you have not already taken the survey, you can help us reach our goal! With this poll, the Wikimedia Foundation gathers feedback on how well we support your work on wiki. It only takes 15-25 minutes to complete, and it has a direct impact on the support we provide.
Please take 15 to 25 minutes to give your feedback through this survey. It is available in various languages.
This survey is hosted by a third-party and governed by this privacy statement (in English).
Find more information about this project. Email us if you have any questions, or if you don't want to receive future messages about taking this survey.
Sincerely,
RMaung (WMF) 20:39, 3 October 2019 (UTC)
Speedy deletion nomination of Category:Disasters in Comoros
A tag has been placed on Category:Disasters in Comoros requesting that it be speedily deleted from Wikipedia. This has been done under section C1 of the criteria for speedy deletion, because the category has been empty for seven days or more and is not a disambiguation category, a category redirect, a featured topics category, under discussion at Categories for discussion, or a project category that by its nature may become empty on occasion.
If you think this page should not be deleted for this reason, you may contest the nomination by visiting the page and clicking the button labelled "Contest this speedy deletion". This will give you the opportunity to explain why you believe the page should not be deleted. However, be aware that once a page is tagged for speedy deletion, it may be deleted without delay. Please do not remove the speedy deletion tag from the page yourself, but do not hesitate to add information in line with Wikipedia's policies and guidelines. UnitedStatesian (talk) 03:17, 22 October 2019 (UTC)
Maps Assistance
Hi there! I noticed you did some work with the ISIS Syria detailed map. I’m looking for someone to help with two or three potential maps, and could compensate for the effort. If interested email me Twillisjr (talk) 23:08, 5 November 2019 (UTC)
ArbCom 2019 election voter message
Google Code-In 2019 is coming - please mentor some documentation tasks!
Hello,
Google Code-In, Google-organized contest in which the Wikimedia Foundation participates, starts in a few weeks. This contest is about taking high school students into the world of opensource. I'm sending you this message because you recently edited a documentation page at the English Wikipedia.
I would like to ask you to take part in Google Code-In as a mentor. That would mean to prepare at least one task (it can be documentation related, or something else - the other categories are Code, Design, Quality Assurance and Outreach) for the participants, and help the student to complete it. Please sign up at the contest page and send us your Google account address to google-code-in-admins@lists.wikimedia.org, so we can invite you in!
From my own experience, Google Code-In can be fun, you can make several new friends, attract new people to your wiki and make them part of your community.
If you have any questions, please let us know at google-code-in-admins@lists.wikimedia.org.
Thank you!
--User:Martin Urbanec (talk) 21:58, 23 November 2019 (UTC)
Placeholder for Infobox Hurricane
Is it necessary to fill out always the parameter basin? Infobox hurricane explicitly says "leave blank only if rare storm outside of main basins". Besides "atl" gives out mph instead of km/h, which is absurd for the Mediterranean.--Carnby (talk) 11:27, 24 November 2019 (UTC)
- It should be filled out, as the default non-basin color is merely grey, which is visually misleading. The problem is that the template syntax doesn't have a better default view. Of course, we could add a separate classification for the Mediterranean region, but it would probably be based on the NHC's system (though the default units in this case would likely be metric). LightandDark2000 🌀 (talk) 06:04, 25 November 2019 (UTC)
- Could I ask directly who maintains the template?--Carnby (talk) 10:44, 25 November 2019 (UTC)
- I don't think that there is a single maintainer for the template. Nor is it updated frequently. The default settings definitely need to be reworked, though. LightandDark2000 🌀 (talk) 19:22, 27 November 2019 (UTC)
- Could I ask directly who maintains the template?--Carnby (talk) 10:44, 25 November 2019 (UTC)
A joyous Yuletide to you!
Merry Christmas and a Prosperous 2020! | |
Hello LightandDark2000, may you be surrounded by peace, success and happiness on this seasonal occasion. Spread the WikiLove by wishing another user a Merry Christmas and a Happy New Year, whether it be someone you have had disagreements with in the past, a good friend, or just some random person. Sending you heartfelt and warm greetings for Christmas and New Year 2020. Spread the love by adding {{subst:Seasonal Greetings}} to other user talk pages. |
Season's Greetings
Merry Christmas and a Prosperous 2020! | |
Hello LightandDark2000, may you be surrounded by peace, success and happiness on this seasonal occasion. Spread the WikiLove by wishing another user a Merry Christmas and a Happy New Year, whether it be someone you have had disagreements with in the past, a good friend, or just some random person. Sending you heartfelt and warm greetings for Christmas and New Year 2020. Spread the love by adding {{subst:Seasonal Greetings}} to other user talk pages. |
March Madness 2020
G'day all, March Madness 2020 is about to get underway, and there is bling aplenty for those who want to get stuck into the backlog by way of tagging, assessing, updating, adding or improving resources and creating articles. If you haven't already signed up to participate, why not? The more the merrier! Peacemaker67 (click to talk to me) 08:19, 29 February 2020 (UTC) for the coord team
Dragon Ball Z Kai episodes
As you've reverted my "Saga" split based on the Japanese DVD releases, could you please add a citation for the American season divisions and names used? The ones in that list aren't the ones used on the American DVDs. LostTL (talk) 15:19, 6 May 2020 (UTC)
Additional vandalism on List of Cyberchase episodes and my efforts to resolve it.
Hello. You and I have previously interacted on Talk:List of Cyberchase episodes regarding the arbitrary and unsourced changes made to the air dates of those episodes by anonymous editors on a repeated basis. As a result of the latest slew of those types of edits, I put in a request for page protection, and also requested further administrative action be taken on the matter here. But it appears as though the admins in relation to this matter only took a cursory look at the page history and the issue in question, and do not seem to realize how wide-spread and lengthy this issue has been to deal with. THey also seem to be under the impression that the problem would easily be resolved if I'd take the initiative to contact all the offending anonymous editors myself, which doesn't seem practical to me. I thought about posting an additional comment on the matter to put the issue into greater context, but worry that the admins feel I may be wasting their time by asking them to intervene. Would you be able to add corroboration and context on this issue to this subject? Perhaps having a second witness to the problems and the length of time in which they have been repeatedly recurring (particuarly directly after page protection has expired every time) may do more than any additional comment I could make personally. Thanks for taking time to address this problem. --Jgstokes (talk) 00:22, 28 June 2020 (UTC)
- @Jgstokes: Sorry for the delay. I was on an extended WikiBreak. Let me just say this first of all; you're better off taking this to either WP:PP or an admin who has some experience dealing with the issues on that page. ANI is much too slow and way too bureaucratic at times; you're better off avoiding the pain that will inevitably come from there altogether whenever possible. The responses there will be varied, depending on the admin reading through the topics at the time, and unless you get an admin who is familiar with this kind of disruption, you could very well get declined altogether if the disruption isn't blatant or obvious. If this nonsense is still continuing right now, I'll leave a request on the talk page of an admin I trust who can handle the issue. LightandDark2000 🌀 (talk) 23:24, 11 July 2020 (UTC)
- @LightandDark2000: I have been on a brief wikibreak myself until today, so I just now saw both of your replies on this matter. I believe I recall you mentioning in the past that using ANI for that type of thing was counterproductive and involved massive bureaucratic red tape that had to be worked through, but I hadn't recalled that at the time I left the OG message in this topic. Because I've taken a bit of time away from Wikipedia to handle other priorities, I haven't checked in on the page in question for about a week or so, so I'm unsure of its' current status. If the vandalism is still a problem, it does appear that my efforts on ANI have hit a standstill. So if it's still a problem, I'd be more than relieved to have you reach out to your admin contact and have that individual handle this issue on more of a long-term permanent basis. Thanks. --Jgstokes (talk) 03:13, 12 July 2020 (UTC)
@LightandDark2000: I just looked into the page history, and it looks as though the pattern is that a number of anonymous editors will wait for page protection to be lifted and work in concert to sabotage the page. Page projection is requested and granted, and the page remains intact. But the minute the paage protection is lifted, a new army of anonymous editors come into the fray to sabotage the page and the contents thereof. So it's still very much going on. I think we need stronger resolution efforts, which, as you rightly pointed out, wouldn't be accomplished by an appeal to ANI. Go ahead and contact your admin buddy. If you need me to corroborate any part of these details, just have that individual reach out to me via my talk page or something. Thanks. --Jgstokes (talk) 03:37, 12 July 2020 (UTC)
- And Done. It's been Semi-Protected for the next 2 months. LightandDark2000 🌀 (talk) 21:43, 13 July 2020 (UTC)
A cookie for you!
Thanks for stopping the vandals at Ness (EarthBound). (Oinkers42) (talk) 03:11, 14 July 2020 (UTC) |
- No problem! :D LightandDark2000 🌀 (talk) 06:08, 14 July 2020 (UTC)
Adding storms before the 1st advisory
Okay. All I need is some clarification. Even if the NHC says they are initiating advisories on a system, shouldn't we WAIT for the 1st advisory BEFORE adding it to the page? That was the impression I got when I first got here, but no one seems to follow, which is making me angry right now.ChessEric (talk) 20:46, 31 July 2020 (UTC)
- I don't think it really matters, as long as the NHC makes it clear that the storm has formed (which they have). As long as editors refrain from adding unofficial/fake data, it should be fine. LightandDark2000 🌀 (talk) 20:48, 31 July 2020 (UTC)
Okay. Thank you.ChessEric (talk) 20:59, 31 July 2020 (UTC)
Userpage styling change
Hey there LightandDark2000, and thanks for your edits to Hurricane Isaias and 2020 Atlantic hurricane season! Your knowledge of storm dissipation dates from the WPC is valuable. I noticed that you changed your userpage styling to make it more like mine and User:Cyclonebiskit's. Cool! I changed my userpage styling by kinda copying the wikicode on Cyclonebiskit's page and putting it on mine, while changing the color and photo. It was just something cool and interesting I noticed. ~ Destroyeraa (talk|Contribs) 01:15, 11 August 2020 (UTC)
- Yeah, I've wanted to stylize my userpage a bit more ever since I first created it. But I didn't have the coding skills back then to carry out many of my designs. After studying some more userpages and gaining some more experience with the code on Wikimedia pages, I finally gained the ability to upgrade various designs on my pages. It's a learning curve. And it's cool how you liked that type design as well. :) LightandDark2000 🌀 (talk) 02:16, 11 August 2020 (UTC)
Wikiproject Military history coordinator election nominations open
Nominations for the upcoming project coordinator election are now open. A team of up to ten coordinators will be elected for the next year. The project coordinators are the designated points of contact for issues concerning the project, and are responsible for maintaining our internal structure and processes. They do not, however, have any authority over article content or editor conduct, or any other special powers. More information on being a coordinator is available here. If you are interested in running, please sign up here by 23:59 UTC on 14 September! Voting doesn't commence until 15 September. If you have any questions, you can contact any member of the coord team. Peacemaker67 (click to talk to me) 02:05, 1 September 2020 (UTC)
Some assistance please
Hey, do you think this is a good picture to use for my page August 2020 California lightning wildfires?: https://scitechdaily.com/nasas-terra-satellite-captures-smoky-pall-over-california-after-unprecedented-lightning-strikes-ignite-more-than-650-wildfires/. I'm not too sure. EagerBeaverPJ (talk) 23:20, 1 September 2020 (UTC)
- I think that it is a good pick. However, it would be even better if you could find an even higher resolution version, especially one from the source site of the satellite images. I can upload the image to Wikimedia Commons later on, if you'd like. LightandDark2000 🌀 (talk) 00:39, 2 September 2020 (UTC)
- I also found this image, but I'll probably use it later in the page. https://scitechdaily.com/1200-mile-trail-of-smoke-stretches-across-california-in-these-nasa-terra-images-of-the-wildfires/. Thanks, though; I think I'll be able to upload that first image then into Wikimedia Commons. EagerBeaverPJ (talk) 01:39, 3 September 2020 (UTC)
- But maybe you could help with the categories, metadata, and others on that page. Not really sure what to do for those. The file is: https://commons.wikimedia.org/wiki/File:NASA-Terra-Smoke-Covered-California-777x808.jpg. EagerBeaverPJ (talk) 20:35, 3 September 2020 (UTC)
- Okay. I'll do that with my Commons account. LightandDark2000 🌀 (talk) 20:36, 3 September 2020 (UTC)
- 👍. Contact me if you have any questions or concerns, and we can discuss it out. EagerBeaverPJ (talk) 20:45, 3 September 2020 (UTC)
- Ok, so you have suggested on the image file to rename it, and I agree with your suggestion. But am I supposed to do anything for that or wait for someone else to deal with it? Because apparently it says this request can be dealt with by an administrator or a filemover, but it also gives me this "Change" option. Though the "Change" option seems to just be a repeat of what you did. EagerBeaverPJ (talk) 23:20, 3 September 2020 (UTC)
- Unless you are an admin or have filemover rights, you can't rename any images on your own at Commons. I know because I've tried it before. This is probably to help curb image-move vandalism. In any event, it appears that someone has taken care of it now. LightandDark2000 🌀 (talk) 18:51, 4 September 2020 (UTC)
- Ok, so you have suggested on the image file to rename it, and I agree with your suggestion. But am I supposed to do anything for that or wait for someone else to deal with it? Because apparently it says this request can be dealt with by an administrator or a filemover, but it also gives me this "Change" option. Though the "Change" option seems to just be a repeat of what you did. EagerBeaverPJ (talk) 23:20, 3 September 2020 (UTC)
2018 Pacific hurricane season
Hey, what do you think about the 2018 Pacific hurricane season? The topic has been steadily progressing over the past several months. NoahTalk 23:07, 4 September 2020 (UTC)
- I think it's pretty well-developed at this point. I'm actually rather impressed. Though a handful of articles still have more room for improvement (particularly the timeline article). LightandDark2000 🌀 (talk) 01:18, 5 September 2020 (UTC)
- Cooper is doing the timeline. I rewrote Hector from scratch due to numerous issues with it (also allowed for expansion). I am working on Walaka on and off with a rewrite for now. Did you see the topic box? Technically speaking, no more FAs are "required", but I still want to get more of the articles I have written to that status. NoahTalk 01:24, 5 September 2020 (UTC)
- Yeah, I saw it. More FAs would be nice, even though it isn't really a "requirement". But the topic as a whole already boasts a collection of high-quality articles. I'd probably be doing more of the quality improvements if I wasn't busy with school. LightandDark2000 🌀 (talk) 01:39, 5 September 2020 (UTC)
- Plan is to get Hector and Walaka to FA by Christmas (along with the current FAC, Vicente). That would leave Bud, Olivia, and the season article for me to get there in 2021. I can only do one at a time (rules) and they often take a month and a half each. The current wikiwork is 1.29 (A-class) for this topic. An interesting thing is that I have initiated every single nomination for the articles in the topic. NoahTalk 01:46, 5 September 2020 (UTC)
- Yeah, you seem to be spearheading the GA/FA campaign in that topic, and probably others as well. It's quite an ambitious drive, and it's nice to see that we have people who are still fleshing out those articles even now, when contributions from the senior members of WPTC is fluctuating. LightandDark2000 🌀 (talk) 01:49, 5 September 2020 (UTC)
- This would be the first featured topic in over 5 years once it gets there. It has taken me (also CB for Lane and Hink + KN for Willa) years to get the current 7 FAs... I have been through 5 back to back FACs since I did Ileana's. I don't plan to take a break this time... I suffered from burnout after the first four FAs I did (19-E, Carlotta, Rosa, and Sergio). NoahTalk 01:54, 5 September 2020 (UTC)
- Yeah, you seem to be spearheading the GA/FA campaign in that topic, and probably others as well. It's quite an ambitious drive, and it's nice to see that we have people who are still fleshing out those articles even now, when contributions from the senior members of WPTC is fluctuating. LightandDark2000 🌀 (talk) 01:49, 5 September 2020 (UTC)
- Plan is to get Hector and Walaka to FA by Christmas (along with the current FAC, Vicente). That would leave Bud, Olivia, and the season article for me to get there in 2021. I can only do one at a time (rules) and they often take a month and a half each. The current wikiwork is 1.29 (A-class) for this topic. An interesting thing is that I have initiated every single nomination for the articles in the topic. NoahTalk 01:46, 5 September 2020 (UTC)
- Yeah, I saw it. More FAs would be nice, even though it isn't really a "requirement". But the topic as a whole already boasts a collection of high-quality articles. I'd probably be doing more of the quality improvements if I wasn't busy with school. LightandDark2000 🌀 (talk) 01:39, 5 September 2020 (UTC)
- Cooper is doing the timeline. I rewrote Hector from scratch due to numerous issues with it (also allowed for expansion). I am working on Walaka on and off with a rewrite for now. Did you see the topic box? Technically speaking, no more FAs are "required", but I still want to get more of the articles I have written to that status. NoahTalk 01:24, 5 September 2020 (UTC)
Would you possibly be willing to review Hurricane Hector against the FA criteria? NoahTalk 22:48, 14 September 2020 (UTC)
- Sorry, but I'm busy with schoolwork at the moment. I might be able to give it a look around the weekend, but no guarantees. You might want to find another experienced editor if you want a review to happen sooner. LightandDark2000 🌀 (talk) 22:50, 14 September 2020 (UTC)
- FACs take multiple reviewers and last over a month generally. NoahTalk 22:57, 14 September 2020 (UTC)
TYSM for helping to make edits to the August 2020 California wildfires page, I greatly appreciate it!! I was initially trying add info to the page for several days, but I was not able to do much because I'm currently facing a huge burden of work in my real life. And additionally no one else ever came to edit till now which made it harder for me. So if you could come and continue to make significant edits to it every day, that would really help! I see you're a really experienced user with over 55,000+ edits. Preferably we should try to make it as good or better than the other major California wildfire event pages (like October 2007, December 2017), for example. I may still try to continue making minor revisions to the page (with regards to more citations and some additional info), and I do have many different articles about the fires from when I was reading about them, so we can discuss about the page if necessary. We can share info and discuss any concerns there might be. But anyways, thanks again! EagerBeaverPJ (talk) 20:47, 8 September 2020 (UTC)
- I can't really edit as much now, due to my workload in College. But I'll drop in when I find the time, especially for major developments. I agree that it's much harder without other people chipping in and helping maintain the articles, particularly if most of the active editors are newbies. Until we get a new "team" or experienced editors consistently working on those articles, I'll help maintain the quality of those articles in my spare time. LightandDark2000 🌀 (talk) 21:17, 8 September 2020 (UTC)
ITN recognition for September 2020 Western United States wildfires
On 14 September 2020, In the news was updated with an item that involved the article September 2020 Western United States wildfires, which you updated. If you know of another recently created or updated article suitable for inclusion in ITN, please suggest it on the candidates page. Stephen 00:12, 14 September 2020 (UTC)
Milhist coordinator election voting has commenced
G'day everyone, voting for the 2020 Wikiproject Military history coordinator tranche is now open. This is a simple approval vote; only "support" votes should be made. Project members should vote for any candidates they support by 23:59 (UTC) on 28 September 2020. Thanks from the outgoing coord team, Peacemaker67 (click to talk to me) 05:18, 15 September 2020 (UTC)
Ianos
Unfortunately, WP:COMMONNAME trumps our naming convention on storms. Medicane Ianos is the most commonly searched version of the storm. NoahTalk 18:00, 24 September 2020 (UTC)
- It was kind of hard to me to tell, based on a cursory look. I'll let the discussion pan out (though to be honest, I could use another trick to move it back to the previous title, but I would rather not make any more unilateral moves at this point.) But our titles need to be balanced between representing the most accurate depiction and the common name. LightandDark2000 🌀 (talk) 18:30, 24 September 2020 (UTC)
TheTimesAreAChanging
LOL the above title user is so narccistic, He just unilatreally changes stuff and so stub-born to change stuff , He only wants his version, I agree with you in spanish flu death toll, Litreally nowhere there is 17 million deaths, Its always 50M+ and i also saw your recent swine flu pandemic change i agree there too, Hope we can change the spanish flu and not include 17-100, but only 50-100 and break the monopoly of thetimesarechanging user, I LIKE YOU SO MUCH :), Your the idol editor for me and my inspirstion thanks for fighting in the spanish flu talk page section!LOVE YOU Swtadi143 (talk) 09:35, 3 October 2020 (UTC)
- I'm not so sure about the narcissistic part, but it is rather unproductive for anyone to try to enforce their preferred version of a page, especially if other editors take issue with it. LightandDark2000 🌀 (talk) 19:02, 3 October 2020 (UTC)
Delta vandal nonsense
Were you trying to put your recent edit for Hurricane Delta in for the past 20 minutes? ChessEric (talk · contribs) 20:10, 9 October 2020 (UTC)
- I was composing it for maybe 30 minutes, and then I ran into that crap when I tried to submit my changes for maybe the last 10 minutes. I eventually decided to wait it out. :P LightandDark2000 🌀 (talk) 20:11, 9 October 2020 (UTC)
- I went away for two hours, and this BS happens, and when I return I have 8 notifications of users and IPs asking for help. ~ Destroyeraa🌀 21:34, 9 October 2020 (UTC)
- @Destroyeraa: I went away in 2014 (actually, moved into Middle Eastern conflict topics), and these serial vandals came back and made a real mess out of the tropical cyclone articles while I was gone. I still feel guilt-ridden over that. I've dealt with plenty of crap during my tenure here. Don't worry, we've seen plenty. You'll get used to it. LightandDark2000 🌀 (talk) 21:40, 9 October 2020 (UTC)
- I went away for two hours, and this BS happens, and when I return I have 8 notifications of users and IPs asking for help. ~ Destroyeraa🌀 21:34, 9 October 2020 (UTC)
Goni
Umm, we have been doing this for a while but Goni is a cat4 per the JTWC BT. Typhoon2013 (talk) 20:44, 29 October 2020 (UTC)
- You can't say that it is a mistake from JTWC BT as your edit summaries as it has been a cat4 since 18Z. So whatever the BT says, then go with it. Typhoon2013 (talk) 20:55, 29 October 2020 (UTC)
- To be honest, I didn't see that in the latest JTWC advisories. LightandDark2000 🌀 (talk) 21:11, 29 October 2020 (UTC)
FYI
I have resigned as an admin and am no longer active on the project. Email notifications are turned off so I only just got your pings when I logged in for some housekeeping. Pings are unlikely to be received in any kind of timely manner if at all. I apologize for any inconvenience. -Ad Orientem (talk) 05:40, 30 October 2020 (UTC)
- Darn. I'm sad to see you go. Take care. LightandDark2000 🌀 (talk) 06:12, 30 October 2020 (UTC)
- For what it's worth, I completely agree with what you've said concerning Wikipedia taking sides in the cultural war. It's sad, and actually, it's a complete disgrace. I haven't experienced any of this crap yet because I've largely kept out of those topics. If this keeps up, I'm going to find some way to take it before the WMF, Jimbo, and maybe more media outlets. If those active editors want their biases to rule this site, then the whole world may as well know that Wikipedia's reputation as a reliable, neutral source has gone right out the window. LightandDark2000 🌀 (talk) 06:35, 30 October 2020 (UTC)
- I agree. Sadly Jimbo Wales isn't in control anymore of the WMF, and there is a new administration. Wikipedia is currently just following mainstream media, because most of the sources are from CNN, ABC, WaPo, NYT, etc. ~ Destroyer🌀🌀 20:13, 11 December 2020 (UTC)
- For what it's worth, I completely agree with what you've said concerning Wikipedia taking sides in the cultural war. It's sad, and actually, it's a complete disgrace. I haven't experienced any of this crap yet because I've largely kept out of those topics. If this keeps up, I'm going to find some way to take it before the WMF, Jimbo, and maybe more media outlets. If those active editors want their biases to rule this site, then the whole world may as well know that Wikipedia's reputation as a reliable, neutral source has gone right out the window. LightandDark2000 🌀 (talk) 06:35, 30 October 2020 (UTC)
Notice of noticeboard discussion
There is currently a discussion at Wikipedia:Administrators' noticeboard/Incidents regarding an issue with which you may have been involved. The thread is 90.255.128.0/17. Thank you. --HurricaneTracker495 (talk) 18:36, 21 November 2020 (UTC)
That idiot
I blocked the range for a month, but I doubt that it's that Wyatt person, given the geolocation of that IP on the SPI and this one--these last few ranges were all based in the UK. There isn't much more we can do; one can only hope that one day their father finds out what they're doing on his computer and lays down the law. Or the dude gets a romantic partner. Drmies (talk) 21:00, 21 November 2020 (UTC)
- @Drimes: there may be collateral for a month long block maybe 2 weeks? HurricaneTracker495 (talk) 00:19, 22 November 2020 (UTC)
- Collateral is unavoidable whenever we're dealing with blocks that span networks. It's something that we'll have to deal with. @Drmies: There was an IPv6 range with similar activity, but at least one of the IPs on that range claimed to be Wyatt2049, which is how I made the connection (not sure how accurate it is, but I'm certain that those IPv6 IPs are his). It's possible that we could have some copycat vandalism here, or that if it is Wyatt2049, that's he's managed to figure out how to use Proxy or VPN networks. LightandDark2000 🌀 (talk) 02:02, 22 November 2020 (UTC)
- That's possible, but for the more fancy footwork you'll have to get a fancier admin. Drmies (talk) 22:36, 22 November 2020 (UTC)
- @Drmies and Zzuuzz: From what I've seen, it's also possible that My Royal Young is involved here (or that MRY is behind the UK IP vandalism and sock accounts, at the very least). Unfortunately, if this is true, this means that this involves an case of Proxy/VPN usage, not to mention that this would take the abuse to a completely different level. LightandDark2000 🌀 (talk) 17:14, 23 November 2020 (UTC)
- I'm afraid I'd need some more specific information to be able to comment, since idiots and IPv6 are unfortunately all too common. However, we do know that MRY is not in the UK, and is unlikely to use certain types of UK IP address with any regularity, so that should be possible to rule out. -- zzuuzz (talk) 18:59, 23 November 2020 (UTC)
- So I managed to find a bit more information about what you're talking about. Information: The UK IPs and impersonations, at least the relevant ones that I've seen, are unlikely to be either Wyatt2049 or (almost certainly not) MRY. Some blocks are already in place, but if pressed, and if it continues, we can probably wield a slightly larger banhammer. (@JavaHurricane:). -- zzuuzz (talk) 20:14, 23 November 2020 (UTC)
- The impersonator, if it is MRY, is impersonating me. Luckily, most established users could tell the difference. Hmmm...I don’t know if the LTA created an account before. Could be an IP LTA.~ Destroyeraa🌀 23:52, 23 November 2020 (UTC)
- @Destroyeraa: could also be Kingshowman, a user known for making impersonating socks such as Deepfriedakro, Deepfriedekre and Creffatt, Craffett and Craffatt, although this one does not tag accounts as socks of random users(like PumpkinEditore declaring an account as a sock of Nkon21). HurricaneTracker495 (talk) 00:24, 24 November 2020 (UTC)
- No, TonyBallioni declared them {{Unrelated}} because there on the wrong continent. --HurricaneTracker495 (talk) 01:23, 24 November 2020 (UTC)
- I didn't check, and I only use the templated responses when I check. I did look at the log, and saw that they were not on the same continent as Kingshowman. Like I said at the SPI, I tend to take the view that figuring out exactly who this is doesn't matter that much. They're blocked, and other CUs have looked at other ways to prevent abuse. Giving them a name doesn't really add much of value at this point, in my opinion. TonyBallioni (talk) 01:28, 24 November 2020 (UTC)
- Zzuuzz, I've turned off pings due to abuse from vandals. Well, it is a relief to hear that it is not MRY who is after me (I've had four impersonation accounts blocked in the last few days, though at least two of them were confirmed to MRY based on lwcu results.) JavaHurricane 09:55, 24 November 2020 (UTC)
- @Zzuuzz, TonyBallioni, and Drmies: Based on a few "Born Again" socks that I've looked at (both of which reference Jesus and exhibit a similar pattern of vandalism on other pages), I believe that this LTA could be Evlekis. Though Wikinger is another possibility if we are dealing with a lot of impersonation or mimicry (though MRY also fits the bill in this scenario). BTW, the rangeblocks on the UK IPs (particularly the /18 range, which is nearing expiration) will almost certainly need to be extended, and talk page access should probably be revoked on all of the ranges at this point. LightandDark2000 🌀 (talk) 21:15, 27 November 2020 (UTC)
- Yes, you probably saw Evlekis. I do want to stress that a number of LTAs, along their respective mimics, operate around here and often do similar stuff, so it's not really worth going into much detail. On the other topic, I'm sure any IP blocks will be appropriately reviewed at the time. Let's not forget that LTAs are a pest, but blocks preventing new editors from editing or signing up to edit are possibly a larger pest. -- zzuuzz (talk) 21:51, 27 November 2020 (UTC)
- @Zzuuzz: Just to be clear, are you referring to just the "Born Again" socks or both the sock accounts and the UK IPs as a whole? LightandDark2000 🌀 (talk) 21:53, 27 November 2020 (UTC)
- You probably know I'm going to be guarded in what I say when it comes to some topics, especially IPs. Born Again, for example here and here and here, is Evlekis. And if I see you requesting a glock or range block of 3-6 months relating to these accounts, I'll be very disappointed. -- zzuuzz (talk) 22:12, 27 November 2020 (UTC)
- I've requested Global Locks on the accounts, given the fact that a number of them have gone cross-wiki (without even taking into account the impersonation and harassment). As for the IP ranges, I haven't requested a Global Block for any of them yet. I'm not going to do that unless I see evidence of cross-wiki vandalism from those ranges (or likely widespread sock creation from a given range, which would be a sharp contrast to what I've been seeing so far). I'm convinced that the one IPv6 range in the U.S. is Wyatt2049, but with the information that I've gathered, I'm starting to think that we may be dealing with 2 separate LTAs and perhaps some copy-catting here. At this point, I still don't know if Wyatt2049 or the UK LTA is the one responsible for the original "God said to me"/"This is God" vandalism on select tropical cyclone articles. LightandDark2000 🌀 (talk) 22:15, 27 November 2020 (UTC)
- As I mentioned before, and I'm sure you know, there are multiple LTAs around, pretty much all the time often doing fairly similar stuff. I will leave you to draw your own inferences about accounts saying "Jesus" a lot, and for example this IP. You know I've dealt with a lot of this nonsense, and I will say that I've still not come across the Wyatt2049 person. I'm sure they're probably not innocent of everything, but the accounts doesn't appear to be them -- zzuuzz (talk) 22:39, 27 November 2020 (UTC)
- I've requested Global Locks on the accounts, given the fact that a number of them have gone cross-wiki (without even taking into account the impersonation and harassment). As for the IP ranges, I haven't requested a Global Block for any of them yet. I'm not going to do that unless I see evidence of cross-wiki vandalism from those ranges (or likely widespread sock creation from a given range, which would be a sharp contrast to what I've been seeing so far). I'm convinced that the one IPv6 range in the U.S. is Wyatt2049, but with the information that I've gathered, I'm starting to think that we may be dealing with 2 separate LTAs and perhaps some copy-catting here. At this point, I still don't know if Wyatt2049 or the UK LTA is the one responsible for the original "God said to me"/"This is God" vandalism on select tropical cyclone articles. LightandDark2000 🌀 (talk) 22:15, 27 November 2020 (UTC)
- You probably know I'm going to be guarded in what I say when it comes to some topics, especially IPs. Born Again, for example here and here and here, is Evlekis. And if I see you requesting a glock or range block of 3-6 months relating to these accounts, I'll be very disappointed. -- zzuuzz (talk) 22:12, 27 November 2020 (UTC)
- @Zzuuzz: Just to be clear, are you referring to just the "Born Again" socks or both the sock accounts and the UK IPs as a whole? LightandDark2000 🌀 (talk) 21:53, 27 November 2020 (UTC)
- Yes, you probably saw Evlekis. I do want to stress that a number of LTAs, along their respective mimics, operate around here and often do similar stuff, so it's not really worth going into much detail. On the other topic, I'm sure any IP blocks will be appropriately reviewed at the time. Let's not forget that LTAs are a pest, but blocks preventing new editors from editing or signing up to edit are possibly a larger pest. -- zzuuzz (talk) 21:51, 27 November 2020 (UTC)
- @Zzuuzz, TonyBallioni, and Drmies: Based on a few "Born Again" socks that I've looked at (both of which reference Jesus and exhibit a similar pattern of vandalism on other pages), I believe that this LTA could be Evlekis. Though Wikinger is another possibility if we are dealing with a lot of impersonation or mimicry (though MRY also fits the bill in this scenario). BTW, the rangeblocks on the UK IPs (particularly the /18 range, which is nearing expiration) will almost certainly need to be extended, and talk page access should probably be revoked on all of the ranges at this point. LightandDark2000 🌀 (talk) 21:15, 27 November 2020 (UTC)
- Zzuuzz, I've turned off pings due to abuse from vandals. Well, it is a relief to hear that it is not MRY who is after me (I've had four impersonation accounts blocked in the last few days, though at least two of them were confirmed to MRY based on lwcu results.) JavaHurricane 09:55, 24 November 2020 (UTC)
- I didn't check, and I only use the templated responses when I check. I did look at the log, and saw that they were not on the same continent as Kingshowman. Like I said at the SPI, I tend to take the view that figuring out exactly who this is doesn't matter that much. They're blocked, and other CUs have looked at other ways to prevent abuse. Giving them a name doesn't really add much of value at this point, in my opinion. TonyBallioni (talk) 01:28, 24 November 2020 (UTC)
- The impersonator, if it is MRY, is impersonating me. Luckily, most established users could tell the difference. Hmmm...I don’t know if the LTA created an account before. Could be an IP LTA.~ Destroyeraa🌀 23:52, 23 November 2020 (UTC)
- So I managed to find a bit more information about what you're talking about. Information: The UK IPs and impersonations, at least the relevant ones that I've seen, are unlikely to be either Wyatt2049 or (almost certainly not) MRY. Some blocks are already in place, but if pressed, and if it continues, we can probably wield a slightly larger banhammer. (@JavaHurricane:). -- zzuuzz (talk) 20:14, 23 November 2020 (UTC)
- I'm afraid I'd need some more specific information to be able to comment, since idiots and IPv6 are unfortunately all too common. However, we do know that MRY is not in the UK, and is unlikely to use certain types of UK IP address with any regularity, so that should be possible to rule out. -- zzuuzz (talk) 18:59, 23 November 2020 (UTC)
- @Drmies and Zzuuzz: From what I've seen, it's also possible that My Royal Young is involved here (or that MRY is behind the UK IP vandalism and sock accounts, at the very least). Unfortunately, if this is true, this means that this involves an case of Proxy/VPN usage, not to mention that this would take the abuse to a completely different level. LightandDark2000 🌀 (talk) 17:14, 23 November 2020 (UTC)
- That's possible, but for the more fancy footwork you'll have to get a fancier admin. Drmies (talk) 22:36, 22 November 2020 (UTC)
- Collateral is unavoidable whenever we're dealing with blocks that span networks. It's something that we'll have to deal with. @Drmies: There was an IPv6 range with similar activity, but at least one of the IPs on that range claimed to be Wyatt2049, which is how I made the connection (not sure how accurate it is, but I'm certain that those IPv6 IPs are his). It's possible that we could have some copycat vandalism here, or that if it is Wyatt2049, that's he's managed to figure out how to use Proxy or VPN networks. LightandDark2000 🌀 (talk) 02:02, 22 November 2020 (UTC)
ArbCom 2020 Elections voter message
Happy Thanksgiving!
🌀Weatherman27🏈 (Chat|Edits|sandbox) has given you a Turkey! Turkeys promote WikiLove and hopefully this has made your day better. Spread the WikiLove by giving someone else a turkey, whether it be someone you have had disagreements with in the past or a good friend. Happy Thanksgiving!
Spread the goodness of turkey by adding {{subst:Thanksgiving Turkey}} to their talk page with a friendly message. |
- Thanks! :D LightandDark2000 🌀 (talk) 21:16, 27 November 2020 (UTC)
- No problem, hope Thanksgiving went great! 🌀Weatherman27🏈 (Chat|Edits|sandbox) 22:45, 27 November 2020 (UTC)
- It was a little depressing and largely uneventful (on a personal level), but otherwise, it was fine. :) LightandDark2000 🌀 (talk) 22:46, 27 November 2020 (UTC)
- i am sorry to hear that, but at least it wasn't bad :) 🌀Weatherman27🏈 (Chat|Edits|sandbox) 22:54, 27 November 2020 (UTC)
- It was a little depressing and largely uneventful (on a personal level), but otherwise, it was fine. :) LightandDark2000 🌀 (talk) 22:46, 27 November 2020 (UTC)
Report moved to ANI
Hi LightandDark2000, I have moved the report to WP:ANI#181.161.160.0/19_reported_by_LightandDark2000. Best regards, ~ ToBeFree (talk) 21:12, 27 November 2020 (UTC)
Barnstar
The Tireless Contributor Barnstar | ||
Thanks for being a dilligent Wikipedian Sliekid (talk) 03:34, 30 November 2020 (UTC) |
- Thanks! LightandDark2000 🌀 (talk) 03:36, 30 November 2020 (UTC)
User sig
I noticed that some past sigs of yours were unbalanced and broke syntax highlighting on the rest of the page where it appeared. This was an old sig, and looks like you've since fixed it, so all is well. That said, you can simplify your current sig code by distributing the bold-italic out:
'''''[[en:User:LightandDark2000|<span style="color:#C69214">Light</span><span style="color:#410064">and</span><span style="color:blue">Dark2000</span>]]''''' 🌀
generates:- FUBAR LightandDark2000 🌀 .
Hope this helps, Mathglot (talk) 09:45, 1 December 2020 (UTC)
- @Mathglot: This was my previous user sig code; however, I was told by a couple of users on Meta that the bold and italic elements "don't like being carried across nested elements", whatever that means. I was also informed of the code causing some kind of syntax issues (maybe in processing or sorting signatures) in the signature window in the user Preferences tab, so I made the suggested changes. My user signature is longer now, but my hope is that this version will avoid the prior issues. LightandDark2000 🌀 (talk) 18:17, 1 December 2020 (UTC)
- I know what it means, but I'm dubious. Whoever told you that on Meta must have been talking about a different version that had a problem because this version is fine. Or else, what they told you is b.s. by someone who has no idea what they are talking about. Here is the generated HTML code from Mediawikia's rendering engine straight out of the bullet on this page just above:
<i><b><a href="/wiki/User:LightandDark2000" title="User:LightandDark2000"><span style="color:#C69214">Light</span><span style="color:#410064">and</span><span style="color:blue">Dark2000</span></a></b></i> 🌀
- which has balanced tags and is completely valid HTML. You can put that through the official HTML 4.1 syntax checker and see for yourself. You need to add some required top-of-page stuff and some end-of-page stuff which are required on all web pages (top line and bottom line in the box below), which gets you this:
- I know what it means, but I'm dubious. Whoever told you that on Meta must have been talking about a different version that had a problem because this version is fine. Or else, what they told you is b.s. by someone who has no idea what they are talking about. Here is the generated HTML code from Mediawikia's rendering engine straight out of the bullet on this page just above:
mediawiki-generated code from "shorter version" to paste into W3C validator
|
---|
|
- then go to the official W3C Markup Validation Service, click the tab 'Validate by direct input', copy-paste the code in the gray box into the input field, and click the "Check" button. It comes back completely clean: valid HTML.
- You should feel completely free to use the shorter version of the wikicode, which Mediawiki's rendering engine converts into 100% valid HTML; this is the same validator that Mediawiki uses to place their "valid HTML" badges on their pages on Meta. So if anybody on Meta claims there's a problem with your shorter version, just point them to this discussion. HTH, Mathglot (talk) 19:54, 1 December 2020 (UTC)
- @Mathglot: This was the main discussion in question. BTW, did you mean that I could use either version of the shortened signature, or should I use the one with the
<i><b>
in my user preferences? LightandDark2000 🌀 (talk) 19:58, 1 December 2020 (UTC)- Your current sig is fine, so you don't really have to do anything. But, if you want to go with the shorter one, just use the version in the first bullet above, i.e. this:
'''''[[en:User:LightandDark2000|<span style="color:#C69214">Light</span><span style="color:#410064">and</span><span style="color:blue">Dark2000</span>]]''''' 🌀
- Of course, you still want to add back in the timestamp part of it after the swirl, i.e., WP:5TILDES. HTH, Mathglot (talk) 20:14, 1 December 2020 (UTC)
- Actually, your suggested changes are slightly different from the version that I had originally used. Thanks. I think I'll implement the changes. :) LightandDark2000 🌀 (talk) 20:21, 1 December 2020 (UTC)
- Your current sig is fine, so you don't really have to do anything. But, if you want to go with the shorter one, just use the version in the first bullet above, i.e. this:
- @Mathglot: This was the main discussion in question. BTW, did you mean that I could use either version of the shortened signature, or should I use the one with the
Misnested tags
By the way: I had just found that Meta discussion while you were typing the link to it above, and yes, *that* version of yours did indeed have misnested tags, just like the version of your sig that got me here in the first place. I was going to point out the same error that xaosflux pointed out to you in 2018, but you'd fixed it by then, using the same fix xaosflux suggested back then.
It's ironic, because just now in your 19:58 response, you made another mis-nested tag error, which screwed up the page again (diff) because you coded this:
<code><nowiki><i><b></code></nowiki>
when you should have coded this:
<code><nowiki><i><b></nowiki></code>
Do you see the difference? That is a mis-nested tag error: the last tag added has to be the first one closed. (I fixed it for you, in this edit.)
There's a good explanation of mis-nested tags somewhere on the site, if you're interested in how to avoid that, should you wish to tweak your sig from time to time going forward, but it's basically LIFO (last-in, first-out) like a stack of trays in a cafeteria, so whatever the last tag was, is the first one that has to come off. Think about how you use (parenthetic comments that contain [bracketed comments], the end bracket-comes first, and then the end-paren), right? Same thing with tag nesting. Make sense? HTH, Mathglot (talk) 20:34, 1 December 2020 (UTC)
- Thanks. I forget that every now and then. But my user sig involved a slightly different issue (or at least, a different variation of it) LightandDark2000 🌀 (talk) 20:35, 1 December 2020 (UTC)
Category:Wikipedia sockpuppets of BlyatPutin has been nominated for merging
Category:Wikipedia sockpuppets of BlyatPutin has been nominated for merging. A discussion is taking place to decide whether this proposal complies with the categorization guidelines. If you would like to participate in the discussion, you are invited to add your comments at the category's entry on the categories for discussion page. Thank you. 4thfile4thrank (talk) 19:08, 3 December 2020 (UTC)
Happy (late) Thanksgiving!
Destroyeraa has given you a Turkey! Turkeys promote WikiLove and hopefully this has made your day better. Spread the WikiLove by giving someone else a turkey, whether it be someone you have had disagreements with in the past or a good friend. Happy Thanksgiving! ~ Destroyer🌀🌀 17:23, 9 December 2020 (UTC)
Spread the goodness of turkey by adding {{subst:Thanksgiving Turkey}} to their talk page with a friendly message. |
I'm thankful to have you here as a fellow member of WPTC, and also of your work fighting LTAs. ~ Destroyer🌀🌀 17:23, 9 December 2020 (UTC)
A barnstar for you!
The Defender of the Wiki Barnstar | |
see above ~ Destroyer🌀🌀 17:24, 9 December 2020 (UTC) |
A barnstar for you!
The Civility Barnstar | |
You've gotten a lot more civil since 2015. ~ Destroyer🌀🌀 17:24, 9 December 2020 (UTC) |
A barnstar for you!
The Writer's Barnstar | |
You write great op-eds. Use that energy to write GAs! ~ Destroyer🌀🌀 17:26, 9 December 2020 (UTC) |
- Aw...Thanks! I'm deeply touched. 3 barnstars. Wow! I don't think I've ever received this many at once. Thanks again! LightandDark2000 🌀 (talk) 06:01, 19 December 2020 (UTC)
Nominations for the 2020 Military history WikiProject Newcomer and Historian of the Year awards now open
G'day all, the nominations for the 2020 Military history WikiProject newcomer and Historian of the Year are open, all editors are encouraged to nominate candidates for the awards before until 23:59 (GMT) on 15 December 2020, after which voting will occur for 14 days. There is not much time left to nominate worthy recipients, so get to it! Peacemaker67 (click to talk to me) 06:45, 10 December 2020 (UTC)
Userbox code
Hi! Just wondering, what is the code for the userbox that says you've visited 2 countries? And, how do you create these edit-notices? 🌀☾⊙☈⊙♫ꍏ🌀 18:38, 14 December 2020 (UTC)
- @Cyclone Corona: Hello! Well, to answer your question, the countries visited userbox is this one:
{{User:Blackadam2/Countries Visited|#2}}
. Just add the userbox to your page and adjust the number inside. To create an editnotice, go the the target page, and enter in "/editnotice". Then, enter in the text that you want. For example, you can check out the editnotice for my talk page. (I also have a separate one for my userpage). Once you finish setting it up, it'll display at the top of the page every time someone opens the editing window. Hope this helps! LightandDark2000 🌀 (talk) 19:10, 14 December 2020 (UTC)- Hi again! For the editnotice thing, it all appears as text on my userpage. So can you help me around that? 🌀☾⊙☈⊙♫ꍏ🌀 19:28, 14 December 2020 (UTC)
- @Cyclone Corona: For an editnotice on your talk page, you need to create this page: User talk:Cyclone Corona/editnotice. If it's on your userpage, the editnotice target would instead be for your user page. And then add your coding to that page. LightandDark2000 🌀 (talk) 19:58, 14 December 2020 (UTC)
- Got it, thanks! 🌀☾⊙☈⊙♫ꍏ🌀 — Preceding undated comment added 20:01, 14 December 2020 (UTC)
- No problem! LightandDark2000 🌀 (talk) 20:05, 14 December 2020 (UTC)
- PS, I forgot to tell you, but the "Editnotice" must be capitalized in order for the editnotice to proply work. Sorry if this caused you any trouble. LightandDark2000 🌀 (talk) 07:09, 16 December 2020 (UTC)
- No problem! LightandDark2000 🌀 (talk) 20:05, 14 December 2020 (UTC)
- Got it, thanks! 🌀☾⊙☈⊙♫ꍏ🌀 — Preceding undated comment added 20:01, 14 December 2020 (UTC)
- @Cyclone Corona: For an editnotice on your talk page, you need to create this page: User talk:Cyclone Corona/editnotice. If it's on your userpage, the editnotice target would instead be for your user page. And then add your coding to that page. LightandDark2000 🌀 (talk) 19:58, 14 December 2020 (UTC)
- Hi again! For the editnotice thing, it all appears as text on my userpage. So can you help me around that? 🌀☾⊙☈⊙♫ꍏ🌀 19:28, 14 December 2020 (UTC)
Season’s Greetings! - Salutations de saison!
Merry Christmas and a Prosperous 2021! | |
Hello LightandDark2000, may you be surrounded by peace, success and happiness on this seasonal occasion. Spread the WikiLove by wishing another user a Merry Christmas and a Happy New Year, whether it be someone you have had disagreements with in the past, a good friend, or just some random person. Sending you heartfelt and warm greetings for Christmas and New Year 2021. Spread the love by adding {{subst:Seasonal Greetings}} to other user talk pages. |
Hey mate, I know you haven't been doing too great all your years (neither have I), and would like to send you my best wishes for the holiday season. Thanks for all you do, from the bottom of my (albeit otherwise empty) heart.
Best wishes,
~ AC5230 talk 21:32, 17 December 2020 (UTC)
Re: barnstar
Thanks so much for the barnstar! Editor retention has been one of my biggest goals over the past few years - maybe even more than writing articles! I'll never forget how welcoming the community was when I first joined. I think that is what has made the WPTC so successful all these years, that community of editors. Keep up your editing, and stay safe/sane these next few months. ♫ Hurricanehink (talk) 16:16, 18 December 2020 (UTC)
- @Hurricanehink: I agree that editor retention is absolutely crucial. After all, without your editors, the articles will soon go stagnant, and newer content will slow to a trickle. I recall that most of the users I interacted with were very Bitey with me when I started. During my first 2 years, you were one of the 3 editors who actually went out of their way to welcome me and even encourage me to register an account (heh, you even invited me to join WPTC). It was your encouragement, and the support of those editors (along with a determination to finally get an account), that led me to register an account after 3 years. I know that some of our other newer editors have experienced a rough start as well. But we're still around. LOL. Fortunately, we don't cave in easily. I do believe that it's paramount to be welcoming and supportive of all new editors who are here in good faith, even if they screw things up a little or have trouble comprehending our practices at first. Anyway, thanks again. I can see that you're still mentoring new users. I think you're doing great! LightandDark2000 🌀 (talk) 23:00, 18 December 2020 (UTC)
A barnstar for you!
The Writer's Barnstar | |
Thank you so much for fixing most issues in Effects of Hurricane Dorian in the Carolinas. SMB99thx my edits! 10:56, 19 December 2020 (UTC) |
- No problem! I'm glad to help out. Thank you for the barnstar! :) LightandDark2000 🌀 (talk) 11:01, 19 December 2020 (UTC)
An Allison for you!
Tropical Storm Allison barnstar | |
Thanks for fixing that error on Tropical Storm Allison, updating the damage. Hurricane Tracker 495 23:43, 19 December 2020 (UTC) |
- @HurricaneTracker495: Aww, Thanks! LightandDark2000 🌀 (talk) 00:00, 20 December 2020 (UTC)
A barnstar for you!
The Teamwork Barnstar | |
Gee, thanks for the barnstars! I really appreciate them, they made my day! It was my brother’s birthday yesterday so I didn’t have time to edit :p, though I still say the barnstars. I just want to tell you that you are a good person and friend, and I’m grateful for your support. ~ Destroyer🌀🌀 17:08, 20 December 2020 (UTC) |
- Many thanks for the barnstar! I really appreciate it! LightandDark2000 🌀 (talk) 19:05, 20 December 2020 (UTC)
ITN recognition for Typhoon Goni (2020)
On 2 November 2020, In the news was updated with an item that involved the article Typhoon Goni (2020), which you updated. If you know of another recently created or updated article suitable for inclusion in ITN, please suggest it on the candidates page. LightandDark2000 🌀 (talk) 01:28, 22 December 2020 (UTC)
ITN recognition for great conjunction
On 21 December 2020, In the news was updated with an item that involved the article great conjunction, which you updated. If you know of another recently created or updated article suitable for inclusion in ITN, please suggest it on the candidates page. LightandDark2000 🌀 (talk) 23:25, 21 December 2020 (UTC)
Medicane
Hi LightandDark! I found this, which is the "official website" of the Mediterranean Cyclone Center. It looks like TheAustinMan's avatar on Discord! Thus, the source is unreliable, and a reliable source copying a name from an unreliable source is unreliable. ~ Destroyer🌀🌀 01:11, 22 December 2020 (UTC)
- @Destroyeraa: That wasn't the source I was using. The website I was using was The Watchers, which I think is completely unrelated. They've been around for much longer than the MCC, and I do feel that they are a reliable source. BTW, I do prefer a direct source from the NOAA database, but I ragequitted after wasting an hour parsing through their database from Hell. And I didn't know that the MCC was actually TheAustinMan. That's actually kind of funny, LOL. Anyhow, I'm not going to revert you over this. LightandDark2000 🌀 (talk) 01:18, 22 December 2020 (UTC)
- I self-reverted myself on the medicine page to your revision, and added a [better source needed] tag. Yeah, exams take a toll on you. However, WP has actually helped me control my stress by taking my mind off of exams and onto hurricanes. You might be wondering why I stopped chatting on Discord. I found out that Discord will let me get carried away chatting :P, and is a distraction when studying for exams. I have an important midterm tomorrow, and I need to get an A on it to bring up my grade. Also, the Great Conjunction wasn’t visible in NJ, we got rain/snow showers :(. Stay safe, and I hope you did well on your exams. ~ Destroyer🌀🌀 02:14, 22 December 2020 (UTC)
- LOL. I figured. Why do you think I dialed back my activity on WP?? Though I probably should have taken more time off Discord. :P Anyway, my grades are mostly finalized now. One of them is still pending, but it's currently at the borderline level. But thanks. I'll tell you more about that off-wiki. Good luck to you as well. :) LightandDark2000 🌀 (talk) 02:50, 22 December 2020 (UTC)
- I self-reverted myself on the medicine page to your revision, and added a [better source needed] tag. Yeah, exams take a toll on you. However, WP has actually helped me control my stress by taking my mind off of exams and onto hurricanes. You might be wondering why I stopped chatting on Discord. I found out that Discord will let me get carried away chatting :P, and is a distraction when studying for exams. I have an important midterm tomorrow, and I need to get an A on it to bring up my grade. Also, the Great Conjunction wasn’t visible in NJ, we got rain/snow showers :(. Stay safe, and I hope you did well on your exams. ~ Destroyer🌀🌀 02:14, 22 December 2020 (UTC)
Happy Holidays!
Hello LightandDark2000: Enjoy the holiday season, and thanks for your work to maintain, improve and expand Wikipedia. Cheers, ~ Destroyer🌀🌀 01:51, 23 December 2020 (UTC)
- Spread the WikiLove; use {{subst:Season's Greetings1}} to send this message~ Destroyer🌀🌀 01:51, 23 December 2020 (UTC)
24.182.9.202
24.182.9.202 (talk · contribs · deleted contribs · filter log · WHOIS · RDNS · RBLs · http · block user · block log) - This guy is making too many unconstructive edits. I'm on my phone so I cannot use Twinkle. Please help me. Thanks. ~ Destroyer🌀🌀 23:47, 23 December 2020 (UTC)
- @Destroyeraa: LOL. :P Well, I think you should be able to use Twinkle if you switch to the Desktop view. But everything takes longer on a phone. Even Rollback. :( I'm already working on it, much to my displeasure. Really? After two months of almost nothing but hard work and trouble, I get this guy two days before Christmas? You must be kidding me. If this continues, I'm not even going to drop another warning. I'm just going to go straight to AVI. LightandDark2000 🌀 (talk) 00:01, 24 December 2020 (UTC)
- Gave 'em a {{uw-disruptive3}}, let's hope they understand. --Hurricane Tracker 495 00:48, 24 December 2020 (UTC)
Happy Holidays!
Hello LightandDark2000: Enjoy the holiday season, and thanks for your work to maintain, improve and expand Wikipedia. Cheers, 𝙲𝚘𝚍𝚒𝚗𝚐𝙲𝚢𝚌𝚕𝚘𝚗𝚎 ᴛᴀʟᴋ 01:22, 24 December 2020 (UTC)
- Spread the WikiLove; use {{subst:Season's Greetings1}} to send this message𝙲𝚘𝚍𝚒𝚗𝚐𝙲𝚢𝚌𝚕𝚘𝚗𝚎 ᴛᴀʟᴋ 01:22, 24 December 2020 (UTC)
Yo Ho Ho
Donner60 (talk) is wishing a foaming mug of Seasons Greetings! Whether you celebrate your hemisphere's Solstice or Christmas, Diwali, Hogmanay, Hanukkah, Lenaia, Festivus or even the Saturnalia, this is a special time of year for almost everyone!
Spread the holiday cheer by adding {{subst:User:WereSpielChequers/Dec20}} to your friends' talk pages.
A Joyous Yuletide to You!
Merry Christmas and a Prosperous 2021! | |
Hello LightandDark2000, may you be surrounded by peace, success and happiness on this seasonal occasion. Spread the WikiLove by wishing another user a Merry Christmas and a Happy New Year, whether it be someone you have had disagreements with in the past, a good friend, or just some random person. Sending you heartfelt and warm greetings for Christmas and New Year 2021. Spread the love by adding {{subst:Seasonal Greetings}} to other user talk pages. |
Yo Ho Ho
M.Bitton (talk) is wishing a foaming mug of Seasons Greetings! Whether you celebrate your hemisphere's Solstice or Christmas, Diwali, Hogmanay, Hanukkah, Lenaia, Festivus or even the Saturnalia, this is a special time of year for almost everyone!
Spread the holiday cheer by adding {{subst:User:WereSpielChequers/Dec20}} to your friends' talk pages.
A barnstar for you!
The Copyeditor's Barnstar | |
You did a lot of copyedits and updates lately. Great job! Also, thanks for promoting Beryl. Five down, we have Florence, Gordon, Michael, and Leslie left! ~ Destroyer🌀🌀 03:09, 27 December 2020 (UTC) |
- Thanks! You did a great job yourself as well! LightandDark2000 🌀 (talk) 03:16, 27 December 2020 (UTC)
- I know Florence will take you and Destroyeraa a decent bit of time to get done. I will try to get Leslie done by the end of the first full week in January and then I can focus on Gordon thereafter. NoahTalk 03:27, 27 December 2020 (UTC)
- Yeah. I think that's our plan. Hopefully we'll be able to have all that done by the summer, time permitting. LightandDark2000 🌀 (talk) 20:48, 27 December 2020 (UTC)
- I know Florence will take you and Destroyeraa a decent bit of time to get done. I will try to get Leslie done by the end of the first full week in January and then I can focus on Gordon thereafter. NoahTalk 03:27, 27 December 2020 (UTC)
@Hurricane Noah:, LightandDark2000: It really was bittersweet seeing Michael Met go. It was a good article that Noah and others put a good amount of time and effort in. ~ Destroyer🌀🌀 21:53, 27 December 2020 (UTC)
- Yeah. But it's probably for the best. LightandDark2000 🌀 (talk) 21:57, 27 December 2020 (UTC)
Website parameter
Re: this edit, I'm not sure you needed to add the |website= parameter for all of the nhc.noaa.gov references. We already list the publisher as the National Hurricane Center. Per Template:Cite_web, the "website" parameter is supposed to list the title of the website, which is the same as the publisher, and not just the url of the homepage. ♫ Hurricanehink (talk) 15:35, 28 December 2020 (UTC)
- I like being thorough, though. Especially when the website of the source isn't straightforward (not easy to find for newcomers). LightandDark2000 🌀 (talk) 19:56, 28 December 2020 (UTC)
Voting for "Military Historian of the Year" and "Military history newcomer of the year" closing
G'day all, voting for the WikiProject Military history "Military Historian of the Year" and "Military history newcomer of the year" is about to close, so if you haven't already, click on the links and have your say before 23:59 (GMT) on 30 December! Peacemaker67 (click to talk to me) 23:35, 28 December 2020 (UTC) for the coord team
Happy New Year!
Thanks for your contributions to Wikipedia, and a Happy New Year to you and yours! ~ Destroyer🌀🌀 21:37, 31 December 2020 (UTC)
- – Send New Year cheer by adding {{subst:Happy New Year}} to user talk pages.
Happy New Year!
Thanks for your contributions to Wikipedia, and a Happy New Year to you and yours! Skarmory (talk • contribs) 23:01, 31 December 2020 (UTC)
- – Send New Year cheer by adding {{subst:Happy New Year}} to user talk pages.
Here
Since you are involved with writing the WPTC newsletter, you may want to check out this. ~ Destroyer🌀🌀 00:43, 2 January 2021 (UTC)
- @Destroyeraa: I noticed that. BTW, the discussion should probably be on the WPTC talk page. I'll be copying the discussion over and add my own response as soon as I'm done with Jebi's FAC review. LightandDark2000 🌀 (talk) 00:47, 2 January 2021 (UTC)
- Thanks! I'll gladly wait for your comments on how awarding MoTM should work. I'm quite new in selecting someone for MoTM. And I'm sorry for reverting your reply for vandalism, it was an accidental mistake. MarioJump83! 00:58, 2 January 2021 (UTC)
- It's okay. I suspected as much. Just be more careful in the future. :) BTW, I have copied over the discussion to the WPTC talk page. LightandDark2000 🌀 (talk) 01:13, 2 January 2021 (UTC)
- Thanks! I'll gladly wait for your comments on how awarding MoTM should work. I'm quite new in selecting someone for MoTM. And I'm sorry for reverting your reply for vandalism, it was an accidental mistake. MarioJump83! 00:58, 2 January 2021 (UTC)
Thanks. Also, Karen 13 is now up to 18K USD in damage. NCDC really helps, though this is still considered minimal damage. ~ Destroyer🌀🌀 01:25, 2 January 2021 (UTC)
A barnstar for you!
The Random Acts of Kindness Barnstar | |
This is for being such a great editor, a kind person, and a hard-worker, as well as coming up with great ideas, and helping me the great people like you here on Wikipedia. 🌀Weatherman27🏈 (Chat|Edits|sandbox) 17:07, 4 January 2021 (UTC) |
@Weatherman27: Aw...Thanks! That really means a lot to me. LightandDark2000 🌀 (talk) 18:46, 4 January 2021 (UTC)
- :-) No problem, you deserve it! 🌀Weatherman27🏈 (Chat|Edits|sandbox) 18:51, 4 January 2021 (UTC)
A barnstar for you!
LTA catcher barnstar | |
Thanks for catching and fighting so many LTAs - most notably IP95 and Wyatt2049. ~ Destroyer🌀🌀 21:43, 4 January 2021 (UTC) |
- Hey, thanks! I'm just doing my part to take out the trash on this site. Someone needs to put up with it. BTW, I saw what you did here. ^_^ LightandDark2000 🌀 (talk) 23:09, 4 January 2021 (UTC)
Happy New Year!
Thanks for your contributions to Wikipedia, and a Happy New Year to you and yours! EkoGraf (talk) 04:53, 5 January 2021 (UTC)
- – Send New Year cheer by adding {{subst:Happy New Year}} to user talk pages.
Its never too late! :) Thank you for a very nice New Year's card and to you too, have a Happy happy New Year!!! :D
You’ve been trouted!
Whack! You've been whacked with a wet trout. Don't take this too seriously. Someone just wants to let you know that you did something silly. |
You have been trouted for: Not keeping your cool when reverting an edit by an IP user. It happens sometimes! -Shift674-🌀 contribs 12:04, 5 January 2021 (UTC)
- Hmm...Well, I actually wasn't losing it yet. Though I did let out a little more than usual on that one (cue Drmies XD). LightandDark2000 🌀 (talk) 12:05, 5 January 2021 (UTC)
Rights requests
Hey there! How do you request page mover rights? ~ 🌀☾⊙☈⊙♫ꍏ🌀 15:25, 8 January 2021 (UTC)
- @Cyclone Corona: Well, go to WP:RFR and file a new request under the appropriate section. However, the Page-Mover and Rollbacker rights do come with more power and responsibility than most of the other rights listed on that page, so I would strongly suggest that you wait another 1 or 2 months before filing a request. You'll have to be able to demonstrate to the reviewing administrators that you have a full understanding of Page Mover rights and the responsibility to handle it. This right is used mainly for moving articles in a manner that would normally not be possible for non-admins and non-page movers (e.g. moving from one name to another without leaving behind a redirect, or moving a redirect and leaving the name blank to allow a page move to that target), and also to revert page-move vandalism. LightandDark2000 🌀 (talk) 20:30, 8 January 2021 (UTC)
- Ok thanks! 🌀☾⊙☈⊙♫ꍏ🌀 20:48, 8 January 2021 (UTC)
- Also, how do you track vandalism? 🦠🌀𝕾𝖚𝖕𝖊𝖗 𝕮𝖞𝖈𝖑𝖔𝖓𝖎𝖈 𝕾𝖙𝖔𝖗𝖒 𝕮𝖔𝖗𝖔𝖓𝖆🌀🦠 19:57, 21 January 2021 (UTC)
- @Super Cyclonic Storm Corona: There are lots of ways to track vandalism. You could go through pages that you know are likely vandal targets, or track pages that log potential vandalism. I assume that you're asking me about tracking live vandalism. Well in that case, you would want to patrol special pages made just for that. Such as Help:Recent changes. I would suggest that you stay out of that one until you're comfortable with finding and reverting vandalism, though. And it's much easier to deal with vandalism using WP:RC if you have Rollbacker rights, though Rollbacker isn't required for anti-vandalism work. LightandDark2000 🌀 (talk) 21:09, 21 January 2021 (UTC)
- Also, how do you track vandalism? 🦠🌀𝕾𝖚𝖕𝖊𝖗 𝕮𝖞𝖈𝖑𝖔𝖓𝖎𝖈 𝕾𝖙𝖔𝖗𝖒 𝕮𝖔𝖗𝖔𝖓𝖆🌀🦠 19:57, 21 January 2021 (UTC)
- Ok thanks! 🌀☾⊙☈⊙♫ꍏ🌀 20:48, 8 January 2021 (UTC)
- Ok, thank you! I hope you get better soon. 🦠🌀𝕾𝖚𝖕𝖊𝖗 𝕮𝖞𝖈𝖑𝖔𝖓𝖎𝖈 𝕾𝖙𝖔𝖗𝖒 𝕮𝖔𝖗𝖔𝖓𝖆🌀🦠 21:30, 21 January 2021 (UTC)
Hurricane Herald Issue 45 sections
When you will write the sections for December 2020 SOTM, SOTY and your OP? (I doubt that the Hurricanehink interview will be ever be written given when Destroyer moved the year report up) MarioJump83! 01:48, 11 January 2021 (UTC)
- I'm planning to start writing those tonight. I should be done by tomorrow. I'm really going to try to get them all finished before tomorrow night. LightandDark2000 🌀 (talk) 03:17, 11 January 2021 (UTC)
Well then, here's our work that just got into fruition! MarioJump83! 00:09, 15 January 2021 (UTC)
A barnstar for you!
The Editor's Barnstar | |
That's my reward for you after getting back into WPTC after all those years. I think you're going to become MoTM some time soon. MarioJump83! 02:17, 11 January 2021 (UTC) |
- Thanks! I am very grateful. LightandDark2000 🌀 (talk) 03:17, 11 January 2021 (UTC)
A kitten for you!
I wish you a speedy recovery. May God watch over you.
~ Destroyeraa🌀🇺🇸 00:19, 12 January 2021 (UTC)
- Thank you so much. LightandDark2000 🌀 (talk) 00:22, 12 January 2021 (UTC)
How are you feeling? ~ Destroyeraa🌀🇺🇸 14:23, 13 January 2021 (UTC)
- You want the truth? Miserable. Even though the pain isn't as bad as it was yesterday. There's nothing like a good shot of pain to remind you of how much your life sucks (if you happen to feel that way, like me).
- Keep thinking optimistic. ~ Destroyeraa🌀🇺🇸 15:07, 13 January 2021 (UTC)
- Ugh. I was never an optimist to begin with, though. Especially not after everything I've been through in life. You should know me better than that by now. I'm more of a realist, or a hopeful realist. Yeah, I'll probably get through this (hopefully the issues I've noticed are only temporary), but as for my life in general, the outlook isn't all that great. LightandDark2000 🌀 (talk) 15:10, 13 January 2021 (UTC)
- Well, you are a hopeful realist. Now that you're operation is finished, I'll get to you off-wiki sometime today. I have a radical but fun idea for WPTC (something similar to the Wikicup). Stay safe. ~ Destroyeraa🌀🇺🇸 15:15, 13 January 2021 (UTC)
- [1] ....😭 LightandDark2000 🌀 (talk) 04:18, 14 January 2021 (UTC)
- Well, you are a hopeful realist. Now that you're operation is finished, I'll get to you off-wiki sometime today. I have a radical but fun idea for WPTC (something similar to the Wikicup). Stay safe. ~ Destroyeraa🌀🇺🇸 15:15, 13 January 2021 (UTC)
- Ugh. I was never an optimist to begin with, though. Especially not after everything I've been through in life. You should know me better than that by now. I'm more of a realist, or a hopeful realist. Yeah, I'll probably get through this (hopefully the issues I've noticed are only temporary), but as for my life in general, the outlook isn't all that great. LightandDark2000 🌀 (talk) 15:10, 13 January 2021 (UTC)
- Keep thinking optimistic. ~ Destroyeraa🌀🇺🇸 15:07, 13 January 2021 (UTC)
Here: User:Destroyeraa/Cyclone Cup. ~ Destroyeraa🌀🇺🇸 16:20, 13 January 2021 (UTC)
- @Destroyeraa: It's a pretty cool idea. I think that we should have those every year! It looks like a version of the WikiCup made just for WPTC. I think that it could be synchronized with Hurricane Noah's new reward system as well. LightandDark2000 🌀 (talk) 17:41, 13 January 2021 (UTC)
- Hehe, I got the idea from Noah's award system. ~ Destroyeraa🌀🇺🇸 18:55, 13 January 2021 (UTC)
- Heh, I bet you're full of creative ideas. LightandDark2000 🌀 (talk) 19:01, 13 January 2021 (UTC)
- Hehe, I got the idea from Noah's award system. ~ Destroyeraa🌀🇺🇸 18:55, 13 January 2021 (UTC)
A Dog for you!
I wish you a very speedy recovery. 🦠🌀𝕾𝖚𝖕𝖊𝖗 𝕮𝖞𝖈𝖑𝖔𝖓𝖎𝖈 𝕾𝖙𝖔𝖗𝖒 𝕮𝖔𝖗𝖔𝖓𝖆🌀🦠 15:03, 12 January 2021 (UTC) |
Thank you! This means so much to me! It's not as bad as I thought it would be right now (mostly because of my pain meds). As long as I properly manage my pain medication and do everything else right, I may be fine. The first 3 days are usually the worst. We'll see how this goes. LightandDark2000 🌀 (talk) 23:07, 12 January 2021 (UTC)
A cup of tea for you!
I was sorry to hear about your health issues and the operation. I hope things are OK! What a rough time to be getting ill. ♫ Hurricanehink (talk) 23:12, 12 January 2021 (UTC) |
- It wasn't necessarily me being ill, but the extraction isn't something casual (the doctor said he considered it to be a "serious surgery"). But thanks! Obviously I can't resume full editing activity right now, but maybe in a few days. In the meantime, I'm keeping my phone close by in case anyone wants to contact me off-wiki. LightandDark2000 🌀 (talk) 23:17, 12 January 2021 (UTC)
A barnstar for you!
The Original Barnstar | |
Sorry to hear about your health and operation. I hope you recover quickly and easy. Cheers. 🌀CycloneFootball71🏈 |sandbox 05:57, 13 January 2021 (UTC) |
- Thank you. I really appreciate your gesture of kindness. LightandDark2000 🌀 (talk) 14:55, 13 January 2021 (UTC)
A kitten for you!
Some days before August 17, 2019 my ankle sprained (non-sports injury - I don't participate in athletic activity) when I'm walking alongside stairs in my school. It was painful and I wasn't able to walk for several days. Fortunately, I was able to recover without any surgery - though I fear that ankle might get injured again. To see you getting a surgery in wisdom teeth removal is probably might be more painful than that - I feel pain and I probably wouldn't be able to handle it! I have wisdom teeth tbh and I don't plan to get it removed someday. This is why I gave you a bicolor kitten. Bicolor cats are my favorite.
MarioJump83! 10:26, 14 January 2021 (UTC)
- Ah, thank you so much. But that's not the #1 issue that's bothering me. You see, 2 of my friends on WPTC now appear to be depressed or have come down with an illness. And with all of that coming together right now, it's just too much for me. LightandDark2000 🌀 (talk) 19:14, 14 January 2021 (UTC)
- Oh man. What a friggin' noodles. This is now Wikipedia's 20th anniversary, and for some reason we all need to get through all of this hell with something happened Destroyer and CF71, including myself for my father's stroke last month. Let's hope that we can all make this through without any of my friends, including you fall. MarioJump83! 23:54, 14 January 2021 (UTC)
45th edition of The Hurricane Herald!
The Hurricane Herald: Wikipedia's 20th Anniversary and New Year's Special Edition!
The Hurricane Herald is the semi-regular newsletter of WikiProject Tropical Cyclones. The newsletter aims to provide in summary the recent activities and developments of the WikiProject, in addition to global tropical cyclone activity. The Hurricane Herald has been running since its first edition ran on June 4, 2006. If you wish to receive or discontinue subscription to this newsletter, please visit the mailing list. This issue of The Hurricane Herald covers all project related events from December 1, 2020–January 15, 2021. This edition's editors and authors are MarioJump83, Hurricanehink, Destroyeraa, Chicdat, Typhoon2013, CycloneFootball71, Hurricane Noah, LightandDark2000, Cyclone Toby (editor's pick for member of the month), Skarmory, Shift674, and HurricaneCovid. Please visit this page and bookmark any suggestions of interest to you. This will help improve the newsletter and other cyclone-related articles. Past editions can be viewed here. | ||||||||||||||||||||||||||||||||||||||||||||
WikiProject Tropical Cyclones: News & Developments New articles since the last newsletter include:
New GA's include:
Typhoon Ike was also promoted from GA to A-class article. Member of the month (Editor's Pick) – Cyclone Toby Cyclone Toby first joined Wikipedia in July 2020 as I like hurricanes. Since then, they have become one of the most active editors, taking the initiative of fulfilling article requests, as well as helping us work on finishing many drafts we have. These articles include Hurricanes in Hispaniola, Hurricanes in Nicaragua, and Hurricanes in Honduras, as well as helping out getting Effects of Hurricane Dorian in the Carolinas (a long-standing draft that took many efforts to get it published to mainspace) nominated for GA, as of this writing. There are more articles Cyclone Toby is currently working on other than the ones previously listed. Also, Cyclone Toby is one of the kinder members of WPTC, actively welcoming many new editors that edited articles under WikiProject Tropical cyclones banner, as well as inviting some of these editors to the project, in which their influence ended up bringing more editors to WPTC without any invitation. We thank Cyclone Toby for work they have done in the past year, which was a horrible year for many of us, but Toby is one of many bright spots that helped us get through that year. As we enter the new year, we encourage Cyclone Toby to keep up their work and eventually complete these drafts, which will ultimately lead to the clearing of the backlog of drafts within the project.
From December 1, 2020 to January 15, 2021, there were no articles promoted to Featured Article status.
There is currently one featured article candidate:
For the next steps of the 2018 Global FT project, we're likely to finish the 2018 Pacific hurricane season FT by the end of the year. Hurricane Bud (2018) is likely to become a Featured Article (FA) around the first anniversary of the 2018 Global FT task force, which will be in June 2021, while Hurricane Olivia (2018) is the most likely FAC next in line. Sooner or later (which might happen before Bud or Olivia is FA), Timeline of the 2018 Pacific hurricane season will be completed, and subsequently nominated for Good Article (GA) status. After that, 2018 Pacific hurricane season might be nominated for Featured Topic (FT) before the timeline or the article is nominated for FA, based on the likely order of completion provided by Hurricane Noah on December 22, 2020 with some changes due to priorities after that time. We also began to focus more attention on the 2018 Atlantic hurricane season FT, as evidenced by Hurricane Beryl and Hurricane Chris (2018) becoming GAs by the time of this issue of The Hurricane Herald, as well as the merger of Meteorological history of Hurricane Michael into Hurricane Michael (despite the merge moratorium which was enacted in November 23, 2020 - this was made possible by getting the consensus for an exception to the merge moratorium), which boosted the prospects of Hurricane Michael becoming a GA by the time of the next issue or the following one. Our next step in the 2018 Atlantic hurricane season FT, as it is currently planned right now, is to have Hurricane Leslie (2018) promoted to a GA. In the Western Pacific, the creation of Effects of Typhoon Mangkhut in the Philippines is still being planned out, while Cimaron, Trami, Kong-rey, and Son-Tinh are in line to be nominated for GA later on - and Jebi may well become a FA by the next issue. In the North Indian Ocean, Cyclone Titli was recently created and likely to be expanded later on. In the Southern Hemisphere, Cyclone Owen is currently being worked on to become a GA someday, while Berguitta, Josie, Keni, and Liua are still under construction. For the Mediterranean, Cyclone Zorbas will be expanded upon and nominated for GA, some time after this issue.
If you are interested in writing new articles, promoting articles to GA, or helping with the FAC review process for the Global 2018 FT project, please reach out to Hurricane Noah or any other member of the 2018 FT task force. WikiProject To-Do
Current assessment table Assessments valid as of this printing. Depending on when you may be viewing this newsletter, the table may be outdated. See here for the latest, most up to date statistics.
Project Goals & Progress The following is the current progress on the three milestone goals set by the WikiProject as of this publishing. They can be found, updated, at the main WikiProject page.
Storm of the month and other tropical activity for December through January 15, 2021 Storm of the month for December – Cyclone Yasa Afterward, Yasa underwent an eyewall replacement cycle as it neared Fiji, causing the storm to weaken. Early on December 17, Yasa made landfall on Bua Province on Vanua Levu, as a powerful Category 4-equivalent tropical cyclone on the SSHWS (Category 5 severe tropical cyclone on the Australian scale). Following landfall, Yasa quickly weakened, dropping back to tropical storm-equivalent status within two days. Afterward, Yasa moved in a southward direction while continuing its weakening trend, falling below tropical cyclone status on December 19, and dissipating on December 24. Yasa killed 4 people in Fiji and left another person missing. As of this writing, the damage estimates for Yasa are still being calculated, but Yasa had caused extensive damage on Vanua Levu, likely becoming the most destructive tropical cyclone to strike Fiji since Winston in 2016.
Storm of the Year 2020 – Hurricane Eta Eta was a powerful and long-lived hurricane that devastated Central America in November 2020. The twenty-ninth tropical depression, record-tying twenty-eighth named storm, twelfth hurricane, and fifth major hurricane of the extremely active 2020 Atlantic hurricane season, Eta originated from a vigorous tropical wave in the eastern Caribbean Sea on October 28. On October 30, the system organized into Tropical Depression Twenty-Nine, before becoming a tropical storm on the next day, at which time it was given the name Eta by the National Hurricane Center (NHC). On November 2, Eta became undergoing rapid intensification over the western Caribbean, as it progressed westward, with the cyclone ultimately becoming a Category 4 hurricane on November 3. Later that day, Eta reached its peak intensity, with 1-minute sustained winds of 150 mph (240 km/h) and a minimum central pressure of 922 mbar (hPa; 27.23 inHg), it was the third-most intense November Atlantic hurricane on record, behind the 1932 Cuba hurricane, and Hurricane Iota, which struck the same region just two weeks later. However, satellite data suggests that Eta may have reached Category 5 intensity at the time of its peak intensity, since reconnaissance aircraft failed to sample the hurricane's strongest winds at the time of its peak intensity. Despite this, in their post-storm report, the NHC maintained Eta as a powerful Category 4 hurricane. Six hours after reaching its peak, Eta underwent an eyewall replacement cycle, causing the storm to weaken somewhat. At 21:00 UTC on November 2, Eta made landfall south of Puerto Cabezas, Nicaragua, with maximum sustained winds of 140 mph (225 km/h) and a central pressure of 940 mbar (hPa; 27.76 inHg). Following landfall, Eta rapidly weakened to a tropical depression by 00:00 UTC on November 5. Despite the mountainous terrain, Eta's low-level circulation survived, and Eta retained tropical depression status for another day, during its two-day trek across Central America, before degenerating into a remnant low overland later on November 5. On November 6, Eta's remnant low moved north over water and regenerated into a tropical depression, before turning towards the northeast. Afterward, Eta reorganized into a tropical storm over the Caribbean on November 7, as it accelerated toward Cuba. On the next day, Eta made landfall on Cuba's Sancti Spíritus Province as a tropical storm, before quickly emerging into the Atlantic and turning westward. Over the next five days, the system moved erratically, making a third landfall on Lower Matecumbe Key in the Florida Keys, on November 9, before slowing down and making a counterclockwise loop in the southern Gulf of Mexico, just off the coast of Cuba, with the storm's intensity fluctuating along the way. Afterward, Eta turned north-northeastward and briefly regained Category 1 hurricane strength on November 11, before weakening back into a tropical storm several hours later. On November 12, Eta made a fourth landfall over Cedar Key, Florida. Eta weakened after making landfall, before eventually re-emerging into the Atlantic later that day. Afterward, Eta became extratropical on November 13, before being absorbed into another frontal system off the coast of the Eastern United States on the next day. In all, Hurricane Eta killed at least 211 people, left 120 people missing, and caused at least $7.9 billion (2020 USD) in damages, with the vast majority of the deaths and damages occurring in Central America. Just two weeks later, Central America was struck by Hurricane Iota as a high-end Category 4 hurricane, making landfall near the same location as Eta, which further exacerbated the disaster in the region. Member of the month (edition) – Jason Rees Jason first created an account on Wikipedia in August 2006, after tracking Hurricane Katrina and countless other storms in 2005. Since then, he has written four featured articles and 21 good articles. Recently, Jason has done great work expanding and cleaning up Cyclone Yasa, one of the strongest storms ever recorded in the South Pacific basin. He is also an active content creator, currently writing Cyclone Meena. Overall, Jason has done an outstanding job expanding the scope of tropical cyclone articles in the Southern Hemisphere basins, such as the South Pacific, where there is, sadly, a shortage of active users. We want to thank him for his wonderful work, and thus award him the Member of the Month award for this edition. New WikiProject Members since the last newsletter More information can be found here. This list lists members who have joined/rejoined the WikiProject since the release of the last issue. Sorted chronologically.
To our new members: welcome to the project, and happy editing! Feel free to check the to-do list at the bottom right of the newsletter for things that you might want to work on. To our veteran members: thank you for your edits and your tireless contributions! A year in review: WPTC's accomplishments in 2020 2020 has been a hard year for many of us. Depending on where you live, the COVID-19 pandemic began as early as January. In most of the world, the pandemic ramped up in February and March, reaching its first peak in April–May. A second wave struck in June–August, which saw cases dramatically increase across the globe, while the third and largest wave began around October. However, during this pandemic, through lock-downs and online learning, as well as the the insanely active 2020 Atlantic hurricane season, our WikiProject saw a huge influx of new editors showing interest in editing tropical cyclone articles. Here, we will take a look at the stats: New WPTC members since January 1, 2020: AC5230, CycloneFootball71 (Previously Weatherman27), Chicdat, Hurricaneboy23, Chlod, Destroyeraa, NOOBSKINSPAMMER, HurricaneMichael2018, JoeMT615, MarioJump83, Buttons0603, Robloxsupersuperhappyface, ChessEric, Allen2, Mazum24, Modokai, CodingCyclone, Gumballs678, Janm 7, Cyclone Toby, Hurricanehuron33, Hurricane21, TornadoLGS, Iseriously, Jupiter50, ARegularWisconsinite, CyclonicStormYutu, ARay10, Gex4pls, Nioni1234, Dannisom, HurricaneCovid, Skarmory, Moline1, HurricaneIcy, Beraniladri19, HurricaneEdgar, Miguel 04012010, Cyclonetracker, Dam222, Hi 022828, Elijahandskip, TovarishhUlyanov, Animem 1, Shift674, Super Cyclonic Storm Corona, ThePelicanThing, FinnTheHurricaneFanatic, 8medalkid, Vida0007, TFESS, Doge1941, Tropical Storm Angela, HurricaneKappa, KingLucarius, Hurricanestudier123, 2 0 D a r t h S a n d M a n 0 5, iBlazeCat, FuturPDUCTIONS, SputtyTheSputnik, AveryTheComrade, Poxy4, SovietCyclone, Gummycow, Chong Yi Lam, German2k2k, Wikihelp7586, StopBoi, Final-Fantasy-HH, TheActiniumSpoon, Ididntknowausername, New GAs since January 1, 2020: Hurricane Erin (1995), Typhoon Halola, 2008 Atlantic hurricane season, Tropical Storm Kirk (2018), Effects of Hurricane Wilma in Mexico, Hurricane Audrey, 2018 Atlantic hurricane season, 1916 Pensacola hurricane, Paleotempestology, 1934 Atlantic hurricane season, 1916 Virgin Islands hurricane, Cyclone Indlala, Typhoon Cecil (1985), Meteorological history of Hurricane Florence, 1929 Bahamas hurricane, 1938 Atlantic hurricane season, Tropical Storm Olga (2019), 1923 Atlantic hurricane season, 1893 San Roque hurricane, 2006–07 South-West Indian Ocean cyclone season, Typhoon Zeke, Typhoon Amy (1991), Typhoon Yunya (1991), Effects of Hurricane Dorian in the Caribbean, Typhoon Sarika, Typhoon Warren, Typhoon Holly (1984), Typhoon Eli (1992), Typhoon Alex (1987), Typhoon Irving (1982), Tropical Storm Bolaven (2018), Tropical Storm Sanba (2018), Tropical Storm Nanmadol (2017), 2018 Pacific hurricane season, Hurricane Dolores (2015), Typhoon Percy (1990), Tropical Storm Ampil, Typhoon Jebi (2018), Tropical Storm Ewiniar (2018), Hurricane Barry (2019), Tropical Storm Bertha (2020), Tropical Storm Arthur (2020), Hurricane Chris (2018), Typhoon Louise–Marge, Cyclone Ava, Hurricane Beryl New FAs since January 1, 2020: Tropical Storm Ileana (2018), Cyclone Chapala, Racer's hurricane, Hurricane Humberto (2019), Tropical Storm Zelda (1991), Hurricane Lane (2018), 1916 Texas hurricane, Hurricane Willa, Meteorological history of Hurricane Dorian, Tropical Storm Vicente (2018), Hurricane Hector (2018), Hurricane Walaka Sockpuppetry in WPTC, by LightandDark2000 Due to recent incidents involving sockpuppetry within WPTC, I invited some editors to address the problem of socking inside the project. MarioJump83! Sockpuppetry is a serious offense committed by various users on Wikipedia. Our own WPTC is not immune to this travesty. WPTC has seen its fair share of abuse from serial vandals and LTAs throughout the years. From 2013 through 2018, IPhonehurricane95 vandalized dozens of tropical cyclone articles and created more than 200 sock accounts. For several years, mostly spanning a two-year period from 2013 to 2014, IPhonehurricane95 defaced numerous tropical cyclone articles, mostly ones that he had once contributed to, were major storms, or were storms in an active tropical cyclone season. He also attacked essentially every single active editor on WPTC at the time, and he went on to attack every single Admin and CheckUser who had ever blocked him, in addition to making making racist remarks and threats of harassment. He eventually went cross-wiki, forcing the intervention of Stewards. In July 2014, he began including graphic 9/11 images in his vandalism, which further damaged the image of the project. IPhonehurricane95's vandalism inspired several copy-cat vandals, including one who has continued to plague the project to this day. This is a problem with LTAs and serial vandals – those who aren't stopped quickly enough and early on often bring bad publicity to the project, in addition to elevating the risk of copycat inspiring knock-offs. In 2016, IPhonehurricane95's socking spree dramatically decreased, with the LTA disappearing in 2018. Sockpuppetry on WPTC has not been nearly as bad since then, but sockpuppetry persisted on WPTC afterward, even to this day. Recent LTAs that WPTC had to deal with include Fly High in the Sky and Wyatt2049, and possibly Evlekis, with the later two engaging in a campaign of vandalism claiming fake Category 5 upgrades (or Category 0 downgrades) "from God" that attracted a lot of bad publicity. Recently, some users dabbled with socking, which got them into trouble. With the recent breaches of trust on WPTC and the confirmation of socking by CUs in several of the newer members, some members of WPTC have called for WPTC members to be vetted by CUs. In the past year alone, a few editors who had recently joined the project came out as sockmasters who went on to become LTAs, further adding to the pressure on WPTC. Personally, I feel that the newer users who joined within the past 6 months with a history of disruption should be examined by a CheckUser, but long-standing CU policy is to not investigate anyone unless there are serious allegations of sockpuppetry (with evidence). This policy exists for good reason, and these requests for blanket CUs may very well be turned down, if proposed. Sockpuppetry is not only bad for the reputation and integrity of the project. It is also harmful to the well-being of editors on the site, especially when they become the targets of attacks. In addition, sockpuppetry breaks the trust of the community when the said offender is a trusted and valued member of the community, no matter the level and duration of the offense. Those editors have to work hard to regain the trust of the community, and in some cases, trust may never be restored. Perhaps equally as bad, sockpuppetry leads to false accusations of the practice and claims of intentional bad faith against both reformed ex-sockpuppeteers and non-socking editors alike. This further damages the reputation of the site, while unnecessarily inflaming tensions between editors on the project and damaging the cohesion between the community. These aspersions also hurt well-meaning editors on the site, and can have the unwanted consequences of embittering them or prompting them to go into retirement. While there are users on WPTC who are dedicated to rooting out and combatting vandals and sockpuppeteers on the site (including some who are a part of the Counter-Vandalism Unit), this is a responsibility that the entire project needs to bear as a whole, since socking is an issue that affects the entire project in one way or another. Editors should be willing and able to investigate potential cases of socking and other types of abusive behavior, while maintaining good faith at the same time. Sockpuppetry is serious issue and an ongoing challenge to the project. Equally as bad are unfounded allegations of the abuse against editors with a long-standing history of being a net-positive. However, together, as a community, we can combat this menace to safeguard the integrity and accuracy of WPTC articles, and make Wikipedia a healthy, productive environment. ~ LightandDark2000 🌀 The Renewal and Growth of WPTC, by LightandDark2000 WPTC had its humble beginnings in the early days of Wikipedia. The WikiProject was founded by Jdorje on October 5, 2005, during the heart of the record-breaking and devastating 2005 Atlantic hurricane season. The founding of WPTC provided a place for editors who had an interest in tropical cyclones to collaborate. Over the next few years, dozens of users flocked to WPTC, growing the ranks to over 60 active members by 2011. This was the first generation of WPTC editors, many of whom had been active on Wikipedia within a few years of its founding in 2001. The first WPTC editors worked hard on improving the quality and quantity of tropical cyclone articles, attaining 100 Good Articles (GAs) and several Featured Articles (FAs) by January 2007. The number of existing TC articles grew each month, with the project boasting 1,000 articles by January 2008. However, as the years passed by, long-time members of the WPTC gradually began dropping out. Reasons included entering college, a busy work schedule, loss of interest in the subject, and retirement from Wikipedia, among other reasons. By January 2011, more than 120 members had either become inactive or had left Wikipedia entirely. By the end of the year, WPTC membership had hemorrhaged to the point where roughly 19 users remained in the WikiProject. As of this writing, the first 13 members on the WPTC roster can be considered the remaining "core" of this first generation that has stayed with the project throughout the years. But the initial WPTC Golden Age was over. The flow of new recruits fell off sharply, and overall interest declined. WPTC would remain at this reduced level of membership and activity for years to come. More users continued to join the WikiProject over the next several years, albeit on a significantly reduced scale. Even then, the vast majority of the work done on tropical cyclone articles were largely carried out by a "core" of roughly a dozen experienced editors who stayed on with the WikiProject throughout the year, even as tropical cyclone activity shifted between the Northern and Southern Hemispheres. However, this reduction in the numbers of active users meant that many more articles ended up being neglected, or suffered from reduced quality. The flow of new GAs and FAs slowed down, and new FACs almost ground to a halt. Some long-time editors, such as Hurricanehink, continued to hammer out TC articles, while recruiting and mentoring new members. The second generation of WPTC editors began showing up in 2013 through 2016, including Nova Crystallis, Typhoon2013, Master of Time, KN2731, and me. (I had edited on Wikipedia for several years before then, but I wasn't officially a part of WPTC prior to 2014.) While new editors continued to join each year, others kept on leaving, and the size of the roster remained around the same size. On a Featured Article review, one of the reviewers even remarked that WPTC was no longer as lively as it once was, with much of the activity having died down. Working on WPTC grew depressing at times, with some of the active editors moving on to other topics when their basins of interest went inactive (usually when the northern hemisphere seasons came to an end). Articles suffered from quality control and content issues in numerous places, especially articles on storms outside of the North Atlantic and East/Central Pacific hurricane basins, where most of the activity from experienced editors was historically concentrated. Articles for storms in the Southern Hemisphere were the hardest-hit, with only a few editors, such as Jason Rees, continuing to work hard on them year-round. As usual, the vast majority of work fell on a tight-knit group of roughly two dozen editors, most of whom were senior editors who had been present since the early days of WPTC. At times, I wondered whether I would ever see the day in which we would have enough active editors on our roster to bring WPTC back to its former glory. From 2016 to 2018, more users joined WPTC, including ChocolateTrain, Hurricane Noah, and MarioProtIV, some of whom would later play a key role in revitalizing tropical cyclone articles or WPTC on some level. In 2018, Hurricane Noah helped restructure some of the internal dynamics of WPTC, including the creation of specific task forces for certain topics and also designing a new award system, in order to help motivate WPTC members and also to help coordinate the work between other editors more effectively. That same year, he kicked off a massive campaign to get more articles to GA and FA status, By late 2020, more than two dozen articles had been brought up to GA or FA status, and WPTC saw its first potential Featured Topic Candidate in more than 6 years (the 2018 Pacific hurricane season). After 2019, the number of new members gradually increased, and activity picked up across the WikiProject. A third batch of new editors showed up between 2018 and 2019, tripling the WPTC roster to 60+ active members. These editors included FleurDeOdile, CycloneYoris, EBGamingWiki, Sandy14156, SaiTheCyclone, DavidTheMeteorologist, JavaHurricane, and others. In 2020, the COVID-19 pandemic struck. Despite the ensuing lockdowns and other fallouts from the pandemic, WPTC saw an explosion of new editors that same year. This 4th generation of editors was, by far, probably the largest influx of new membership that WPTC had ever seen. By the end of the year, the active membership roster had exploded from 69 to 124 active members. Our newer members from 2020 include AC5230, CycloneFootball71, Chicdat, Hurricaneboy23, Chlod, Destroyeraa, MarioJump83, ChessEric, Modokai, CodingCyclone, Cyclone Toby, TornadoLGS, HurricaneCovid, Skarmory, and many, many others. The wait was finally over. New life had been breathed back into WPTC. It was almost as if the good old days of the WikiProject were starting to return. While we've had our ups and downs this year, the influx of new editors infused WPTC with much-needed new blood and also helped relieve the senior editors of some of the burdens they've had to bear for years. Our hope is that the vast majority of these new editors will stay with us going forward, even as tropical cyclone activity cycles on and off across the world. Even after the pandemic-related lockdowns end. In closing, I want to thank my fellow WPTC editors for my experience. When I first started as an IP editor on Wikipedia more than a decade ago, I never imagined that WikiProjects existed, not to mention one specifically tailored for tropical cyclones. I had a rough start here, with a bitey reception from most of the others who communicated with me, while also struggling to learn some of Wikipedia's fundamental policies (particularly citations). However, I eventually eased into the place and the others warmed to me, and my proficiency in editing improved as I spent more time on Wikipedia. The truth is, whenever I came under pressure in other areas of Wikipedia, whether it is from hounding, witch hunts, attacks, or other hostile behavior, I've always retreated back to WPTC. Why? Because I've always felt much more welcome here. And safe. In some ways, WPTC has become my home on Wikipedia. I've gotten so much more out of here than I had expected to as well. My time on Wikipedia helped sharpen my writing (and typing) skills, which was a rather nice bonus. I've also made a number of new friends here (some of whom I've grown rather close with), all of whom I enjoy working with. Thank you, all of you, for everything. Thank you for showing me what the Wikipedia experience should be like, and thank you for being willing to befriend me. I look forward to continue working with you all and growing with you in the years to come. May you all have a wonderful 2021! ~ LightandDark2000 🌀 My stress, by MarioJump83 Hello, this is my first opinion piece on Hurricane Herald as MarioJump83. In this opinion piece, I want to explain why I'm not as active as I'm hoping for in recent weeks. I do not plan to ever make this opinion piece at all, but I had to speak out about my issue with my activity in order to balance this edition of Hurricane Herald as well as to prevent attempts at adding my work-in-progress opinion piece to this issue because I'm planning to package that opinion piece with a long-finished but unfortunately delayed opinion piece. I want to apologize for delaying my work-in-progress opinion piece numerous times, given there are numerous issues about it, one of which (stress) will be addressed in this opinion piece. Since last December, I have repeatedly have been on semi-wikibreaks. Wikipedia, as I know it, is a serious business. I was no longer the "nice guy" when I got my MoTM. Stress has been building up as I faced college exams as well as my father's stroke which happened on December 17, 2020. I attempted to break this semi-wikibreak once as I requested to change my name from SMB99thx into MarioJump83 for a breath of a fresh air (some days before that I requested deletion of my userpage for the same reason), and did some AfC reviewing spree in January 2 and 3. But as it turns out, it was quite a failure as three AfC submissions I accepted ended up being in jeopardy, with me trying to save the last one standing. I think these experiences ruined my chance to become a permanent new page reviewer, pushed me back into my semi-wikibreak once more and I had to enroll myself into New Page Patrol School in hopes of getting back into what I wanted. As such, I decided to commit into content creation as I was granted page mover rights (temporary) on January 4. As of now, I'm trying my best to come out on this second semi-wikibreak, bringing myself out of trouble that I didn't intend to participate in and planning to become autopatrolled some day as the college exams are winding over. Wish me and my family for the best in the coming weeks, anyone! I'm hoping that it will happen after the release of this issue, if not later. By the way - even when I'm still stressed - I am going to wish everybody Happy New Year and Happy 20th Wikipedia anniversary! (Don't forget that we also reached edit number 1,000,000,000!) |
A kitten for you!
I am sorry to hear that you aren't feeling great. I hope things get better for you.
🌀CycloneFootball71🏈 |sandbox 04:57, 15 January 2021 (UTC)
Thanks. Though I still am experiencing physical pain/discomfort (not quite as bad now, thankfully), this one is largely emotional. And unfortunately, this kind of pain is much more difficult to deal with. LightandDark2000 🌀 (talk) 05:00, 15 January 2021 (UTC)
- I am glad that your physical pain has decreased. Especially now, I now how that other kind of pain feels, all too well. Anyhow, I hope you feel better and things trend up for you soon. Cheers, 🌀CycloneFootball71🏈 |sandbox 05:04, 15 January 2021 (UTC)
- Thanks! BTW, I also noticed what happened in mid-December 2020. I'm very sorry. I was very preoccupied with my finals and the associated stress back then, so I didn't even notice at the time. I hope that you'll re-emerge from your dark times as well. I wish you the best. LightandDark2000 🌀 (talk) 05:01, 16 January 2021 (UTC)
- Oh, yeah very unfortunate timing with that, which is one of the reasons why I kind of retired. Thanks though I hope I can emerge from this stressful period as well. Thanks you, 🌀CycloneFootball71🏈 |sandbox 20:33, 21 January 2021 (UTC)
- Thanks! BTW, I also noticed what happened in mid-December 2020. I'm very sorry. I was very preoccupied with my finals and the associated stress back then, so I didn't even notice at the time. I hope that you'll re-emerge from your dark times as well. I wish you the best. LightandDark2000 🌀 (talk) 05:01, 16 January 2021 (UTC)
A barnstar for you!
The Special Barnstar | |
Hi there! I've been talking to you lately, and seem like a really great person. I noticed you have been going through some stuff, so hopefully this barnstar will cheer you up a bit. Best of luck, 𝙲𝚘𝚍𝚒𝚗𝚐𝙲𝚢𝚌𝚕𝚘𝚗𝚎 ᴛᴀʟᴋ 17:31, 15 January 2021 (UTC) |
- Thanks! I'm still feeling down (though not quite as much as I was only a day ago), but this definitley helped cheer me up a little. :) LightandDark2000 🌀 (talk) 05:01, 16 January 2021 (UTC)
A kitten for you!
Thanks for your contributions. Always be happy.
Dam222 🌋 (talk) 07:14, 16 January 2021 (UTC)
- Thank you! LightandDark2000 🌀 (talk) 19:40, 22 January 2021 (UTC)
Rogue editor
I note that you have commented on the edits made by a user with the ID 82.1.133.50 on the Balfron article. He is at it again, and again. Are you able to prevent him from further vandalism? Shipsview (talk) 22:31, 18 January 2021 (UTC)
- @Shipsview: I reported the vandal to WP:AIV. Unfortunately, I cannot actually block them myself, because I'm not an administrator. We'll have to wait until an admin gives my report a look. I can also try contacting some admins on Discord if it gets really bad. LightandDark2000 🌀 (talk) 22:55, 18 January 2021 (UTC)
- Thank you Shipsview (talk) 14:02, 19 January 2021 (UTC)
A barnstar for you!
The Defender of the Wiki Barnstar | |
Thank you for reverting vandalism whenever it occurs, thus saving Wikipedia. ~~ 🌀𝕾𝖚𝖕𝖊𝖗 𝕮𝖞𝖈𝖑𝖔𝖓𝖎𝖈 𝕾𝖙𝖔𝖗𝖒 𝕮𝖔𝖗𝖔𝖓𝖆🌀 16:54, 22 January 2021 (UTC) |
Thanks! I'm just doing my part to defend Wikipedia and the other editors here (when it becomes necessary). :) LightandDark2000 🌀 (talk) 19:40, 22 January 2021 (UTC)
A barnstar for you! - Un EtoileDeGrange pour vous!
The Random Acts of Kindness Barnstar | Les actes de bonté au hasard EtoileDeGrange | |
Hello! Thanks for all the WikiLove and nice messages; as well as the help. Hopefully time does you better now than before. Stay safe! ~ AC5230 talk 17:16, 22 January 2021 (UTC) | salut! Merci pour tout le WikiLove et les bons messages; ainsi que l'aide. J'espère que le temps vous fera mieux maintenant qu'avant. Restez en sécurité! ~ AC5230 talk 17h16, 22 janvier 2021 (UTC) |
- @AC5230: Thank you very much! Yes, I am feeling much better now. Even though I'm still recovering. I hope that life is treating you better as well. ^_^ LightandDark2000 🌀 (talk) 19:40, 22 January 2021 (UTC)
A pineapple cake for you!
A pineapple cake for you! | |
This pineapple cake I present to you is a virtual one. It's a picture of one I ate today. I made sure to take a picture and upload it before I ate it. It's made in Taiwan and has a very buttery taste. Suits your sweet cravings well. Enjoy ^_^ ~ Destroyeraa🌀🇺🇸 01:17, 23 January 2021 (UTC) |
- Aww...Thank you so much! I love those!! Yum! Now I really want to have another pineapple cake in real life. LOL! XD LightandDark2000 🌀 (talk) 01:20, 23 January 2021 (UTC)
"Devastator (Ratchet and Clank)" listed at Redirects for discussion
A discussion is taking place to address the redirect Devastator (Ratchet and Clank). The discussion will occur at Wikipedia:Redirects for discussion/Log/2021 January 23#Devastator (Ratchet and Clank) until a consensus is reached, and anyone, including you, is welcome to contribute to the discussion. Regards, SONIC678 03:16, 23 January 2021 (UTC)
A cookie for you!
I think I'll keep this cookie to my self.. just kidding. Anyways, I think it's wonderful that your still editing articles daily despite this minor inconviences. Though this may not be the same kind of pain that you feel, I do get headaches like two to three times every couple of months. While it's really not that frequent, it really hurts. Though I also have chipped one of my teeth before. That felt weird. Oh well. I wish you a fast recovery. Stay safe, Cyclone Toby 02:23, 24 January 2021 (UTC) |
- Aww...Thanks! I am feeling much better now. Full recovery will probably take 5 months, but things should mostly be back to normal for me within a week. I do appreciate the gesture of kindness. And I hope that you're feeling well yourself. LightandDark2000 🌀 (talk) 02:42, 24 January 2021 (UTC)
Vandalism Help
I saw that you have reverted edits on the John Giuca page made by 2 editors. There is now a third editor on the page that has (it looks like) made 500 edits in the past 24 hours...It looks IMO like a sockpuppet account due to his editing ability and since the IP/editor is so new. He is positioning the page as an article about the CASE vs. about Giuca himself. He has also removed information sourced from the NYTimes about a prior shooting arrest. In all, after spending much time on this page and reviewing the talk page and edit history I believe these editors are closely connected with the defendant's family. Are you able to help prevent 2603:7000:2143:8500:31b5:246a:5626:edca from further vandalism? Please let me know if you have any ideas on next steps. Looking for help/answers. Thank you! Drsammyjohnson (talk) 01:23, 27 January 2021 (UTC)
- @Drsammyjohnson: Well, you could open an SPI case page on the person, under the name of the original account, SMALLS88, assuming that they are socking (which is a real possibility). If you do, be sure to provide evidence relating to how the accounts and IPs are related behaviorally. In the meantime, however, you can report the latest IPs. to WP:AIV to stop any ongoing disruption. I'm not sure if the person behind the newer IPs is the same individual, but the activity does look suspicious. Hope this helps. LightandDark2000 🌀 (talk) 01:52, 27 January 2021 (UTC)
- @LightandDark2000: Thank you for the help. Links to relevant pages are so useful - sometimes I find myself getting lost in Wikipedia "how to" pages. I too find the editing suspicious. I will dig in further. Much appreciated. Drsammyjohnson (talk) 03:23, 27 January 2021 (UTC)DrSammyJohnson
- Light - please take a careful look at the reverted edits. There is zero suspicious about them. And they are not in the least what Sammy imagines them to be. As was explained to Sammy - he is imagining things, wildly. See discussion here.[2] BTW, I am not as new as Sammy imagines - the computer link just changes on its own on a regular basis to a new IP address, without my direction. This is not uncommon with IP addresses. As far as opening an SPI - sure, go ahead. I'm not a sockpuppet. Nor of course are my edits in the least in line with the edits of the editors that Sammy is upset at. Truly a weird accusation. Totally baseless. And I cannot imagine why, after I explained this all to him, he continues to state flatly incorrectly that "He has also removed information sourced from the NYTimes about a prior shooting arrest." Just the opposite. Bizarre. You will see this if you look at the reverted edits. In short, there is no disruption caused by my edits. There is major disruption caused by Sammy. In his deletion of text, all to RSs such as the NYT, all in an objective tone, without any leaning towareds (or away from) any party to the event. Unhinged accusations, and disruptive editing. 2603:7000:2143:8500:2106:A7BD:74CF:9D46 (talk) 19:11, 27 January 2021 (UTC)
- Light - since you've given an opinion - I assume, correct me if I am wrong - without looking at the actual edits to see if they match the accusation and are therefore as charged "suspicious" or are just the opposite (they are) - might you perhaps if you can find a moment take a look at the edits to correct your assertions if you believe that would be appropriate? This editor has completely misstated to you the content of those revisions. 2603:7000:2143:8500:69BB:9C10:91C2:DFF0 (talk) 07:11, 30 January 2021 (UTC)
- I was mostly thinking of another slew of vandal accounts/IPs from before that were almost certainly the same person. Not necessarily you or all of your edits (though I will admit that some of your earlier edits did look a little suspicious in terms of the timing). Anyhow, this is starting to look more like a content dispute between the two of you. I strongly urge the two of you to discuss the issue and come to an agreement, instead of engaging in an edit war on the article itself. LightandDark2000 🌀 (talk) 07:19, 30 January 2021 (UTC)
- Thanks. I imagine it is possible that at first he was thinking of other IPs as well. I stand behind all my edits, he has wildly and incorrectly mischaracterized them,, and I did engage him in talk page discussion starting four days ago to try to understand his complaints, which I responded to at length - only to discover there is nothing to them. See here.[3] I have no idea what you are referring to as far as "suspicious timing" - the content of my edits, though, bears close inspection. This editor for example oddly accused me of deleting NYT references - I doubt that ever happened at all, and he failed to point to any, and I in fact added many NYT references. Just an absolutely baseless and disruptive revert, that goes far beyond normal editing disputes. 2603:7000:2143:8500:1D36:6FB6:FDDA:9EB2 (talk) 06:18, 1 February 2021 (UTC)
- I was mostly thinking of another slew of vandal accounts/IPs from before that were almost certainly the same person. Not necessarily you or all of your edits (though I will admit that some of your earlier edits did look a little suspicious in terms of the timing). Anyhow, this is starting to look more like a content dispute between the two of you. I strongly urge the two of you to discuss the issue and come to an agreement, instead of engaging in an edit war on the article itself. LightandDark2000 🌀 (talk) 07:19, 30 January 2021 (UTC)
- Light - since you've given an opinion - I assume, correct me if I am wrong - without looking at the actual edits to see if they match the accusation and are therefore as charged "suspicious" or are just the opposite (they are) - might you perhaps if you can find a moment take a look at the edits to correct your assertions if you believe that would be appropriate? This editor has completely misstated to you the content of those revisions. 2603:7000:2143:8500:69BB:9C10:91C2:DFF0 (talk) 07:11, 30 January 2021 (UTC)
- Light - please take a careful look at the reverted edits. There is zero suspicious about them. And they are not in the least what Sammy imagines them to be. As was explained to Sammy - he is imagining things, wildly. See discussion here.[2] BTW, I am not as new as Sammy imagines - the computer link just changes on its own on a regular basis to a new IP address, without my direction. This is not uncommon with IP addresses. As far as opening an SPI - sure, go ahead. I'm not a sockpuppet. Nor of course are my edits in the least in line with the edits of the editors that Sammy is upset at. Truly a weird accusation. Totally baseless. And I cannot imagine why, after I explained this all to him, he continues to state flatly incorrectly that "He has also removed information sourced from the NYTimes about a prior shooting arrest." Just the opposite. Bizarre. You will see this if you look at the reverted edits. In short, there is no disruption caused by my edits. There is major disruption caused by Sammy. In his deletion of text, all to RSs such as the NYT, all in an objective tone, without any leaning towareds (or away from) any party to the event. Unhinged accusations, and disruptive editing. 2603:7000:2143:8500:2106:A7BD:74CF:9D46 (talk) 19:11, 27 January 2021 (UTC)
- This editor is completely irrationally disruptive. I posted responses to all of his fictitious complaints.[4] I waited days. His responses ended. I restored his disruptive no-rational-basis deletions. Now this.[5] How can I proceed? I have tried - at length, and spending time that was not appropriate given the simplicity of the non-issues - and we are back where we started. He is irrational. I need a third party. If need be, he could be blocked, but I wish him no harm - he is just not rational (then again, if he does this to other articles, it is a drag on wp resources). How would you suggest I proceed? 2603:7000:2143:8500:A1A3:633:94F3:E5BF (talk) 09:56, 6 February 2021 (UTC)
- Hi. I would suggest opening up a new discussion on the article's talk page. Start a discussion on the disupted content at hand. Also try to bring in other editors who have been active on that page or who have an interest in that topic, to try to get consensus on the changes. Bringing in more editors should help with getting additional opinions and coming to a resolution. A last resort would be WP:ANI if all else fails, but I don't want to see anyone getting dragged before ANI for a content dispute issue. LightandDark2000 🌀 (talk) 20:07, 6 February 2021 (UTC)
Super Cyclonic Storm Corona has eaten your pie!
Super Cyclonic Storm Corona has eaten your pie! The pie made them happy and they'd like to give you a great big hug for donating it. Spread the WikiLove by giving out more pies, whether it be someone you have had disagreements with in the past or a good friend. Thanks again! ~~ 🌀𝕾𝖚𝖕𝖊𝖗 𝕮𝖞𝖈𝖑𝖔𝖓𝖎𝖈 𝕾𝖙𝖔𝖗𝖒 𝕮𝖔𝖗𝖔𝖓𝖆🌀 19:04, 28 January 2021 (UTC)
- Aw! You're welcome! I'm glad I made you happier. LightandDark2000 🌀 (talk) 19:36, 28 January 2021 (UTC)
Woah man, calm down. You don't have to say mean words like that. ~~ 🌀𝕾𝖚𝖕𝖊𝖗 𝕮𝖞𝖈𝖑𝖔𝖓𝖎𝖈 𝕾𝖙𝖔𝖗𝖒 𝕮𝖔𝖗𝖔𝖓𝖆🌀 17:33, 3 February 2021 (UTC)
A brownie for you!
Sorry to see you are miserable again. Hopefully this delicious brownie will make you feel better. ~~ 🏅🌀𝕾𝖚𝖕𝖊𝖗 𝕮𝖞𝖈𝖑𝖔𝖓𝖎𝖈 𝕾𝖙𝖔𝖗𝖒 𝕮𝖔𝖗𝖔𝖓𝖆🌀🏅 21:30, 5 February 2021 (UTC) |
- Aw...Thank you so much for your kind words, and the treat! Many thanks!! :) LightandDark2000 🌀 (talk) 21:35, 5 February 2021 (UTC)
Alongside working to get successful Cyclone Owen PR I am considering GAN of 2006 Central Pacific cyclone despite being small in size I acknowledge. From what I learned from Hurricane Kristy (2006) merger, Hurricane Sergio (2006) is probably going to not hold out any longer so I see 2006 Central Pacific cyclone as a replacement. MarioJump83! 05:11, 9 February 2021 (UTC)
- The article isn't quite ready yet. The impacts section definitely needs more expansion, and I'd like to see some more information in the Met History section as well, if possible. I'll be more than happy to take a look when the article is finally reworked for a GAN, but I won't really have the time to pull that off until the summer. We have a number of rather small GAs, so size shouldn't be too much of an issue. LightandDark2000 🌀 (talk) 06:51, 9 February 2021 (UTC)
A pie for you!
I am thankful that you are very helpful to me by assisting my GAR on Pacific Meridional Mode, and didn't actively participate in holding back our (me and Chicdat - We are working together by this point I admit) Cyclone Owen GA efforts onwiki. Here is a pie for being so nice on the Wikipedia! BTW, I hope you become a global rollbacker someday - but now is better than ever, you should request it here! JavaHurricane is one of our global rollbackers in WPTC! MarioJump83! 05:13, 9 February 2021 (UTC) |
To tell about my user rights I'm on, I'm now Destroyeraa but with temporary page mover instead of permanent one. LOL! MarioJump83! 05:57, 9 February 2021 (UTC)
- Also... I'm Destroyeraa with a little bit terrible grammar and sometimes emotional! MarioJump83! 06:10, 9 February 2021 (UTC)
- LOL! So you have more user rights to enjoy now, I see. :P Anyhow, thanks for your support and the pie. Yum! LightandDark2000 🌀 (talk) 06:51, 9 February 2021 (UTC)
A kitten for you!
Skarmory has given you a kitten! Kittens promote WikiLove and hopefully this one has made your day better. Your kitten must be fed three times a day and will be your faithful companion forever! Spread the WikiLove by giving someone else a kitten, whether it be someone you have had disagreements with in the past or a good friend.
Spread the goodness of kittens by adding {{subst:Kitten}} to someone's talk page with a friendly message, or kittynap their kitten with {{subst:Kittynap}}
- Thanks! LightandDark2000 🌀 (talk) 04:22, 15 February 2021 (UTC)
Happy Valentine's Day/Singles' Awareness Day!
Valentine Greets!!! | |
Hello LightandDark2000, love is the language of hearts and is the feeling that joins two souls and brings two hearts together in a bond. Taking love to the level of Wikipedia, spread the WikiLove by wishing each other Happy Valentine's Day, whether it be someone you have had disagreements with in the past, a good friend, or just some random person. Spread the love by adding {{subst:Valentine Greetings}} to other user talk pages. |
I do hope you're doing well. CodingCyclone citation needed 20:49, 14 February 2021 (UTC)
- Aw, thank you so much! I hope you're also doing well yourself. And Happy Valentine's Day! LightandDark2000 🌀 (talk) 04:22, 15 February 2021 (UTC)
A barnstar for you!
The Writer's Barnstar | |
For merging the Tropical Storm Cristobal (2020) and Tropical Storm Amanda (2020) articles into the Tropical Storm Amanda–Cristobal article by yourself. Great job man! ChessEric (talk · contribs) 22:38, 25 February 2021 (UTC) |
- Thanks! I'm glad you appreciated my work. LightandDark2000 🌀 (talk) 22:51, 25 February 2021 (UTC)
- Why were they merged? ~ 🌀 SCS CORONA 🌀 13:41, 26 February 2021 (UTC)
- @Super Cyclonic Storm Corona: Because they were always the same storm to begin with. And in the case of Amanda–Cristobal, the remnant low survived and regenerated into Cristobal. The only reason why they were given two names is because of a stupid NHC policy that if a storm doesn't make it into a different basin as a tropical cyclone (at least as a tropical depression), then it must be given a new name. Even if it's the same storm. On WP, we give the storm one article if the low-pressure area (LPA) or the low-level circulation center (LLCC) survives the trip overland, I think. Even if the NHC gives them two separate names. Which is why we had the discussion to merge the two articles. And yesterday, I did just that. LightandDark2000 🌀 (talk) 16:43, 26 February 2021 (UTC)
- Ah, ok. I understand. ~ 🌀 SCS CORONA 🌀 16:46, 26 February 2021 (UTC)
- @Super Cyclonic Storm Corona: Because they were always the same storm to begin with. And in the case of Amanda–Cristobal, the remnant low survived and regenerated into Cristobal. The only reason why they were given two names is because of a stupid NHC policy that if a storm doesn't make it into a different basin as a tropical cyclone (at least as a tropical depression), then it must be given a new name. Even if it's the same storm. On WP, we give the storm one article if the low-pressure area (LPA) or the low-level circulation center (LLCC) survives the trip overland, I think. Even if the NHC gives them two separate names. Which is why we had the discussion to merge the two articles. And yesterday, I did just that. LightandDark2000 🌀 (talk) 16:43, 26 February 2021 (UTC)
- Why were they merged? ~ 🌀 SCS CORONA 🌀 13:41, 26 February 2021 (UTC)
Thanks for the thank
Hungry? You can eat it if you need to, because I want to say thanks for the thank. :S ImaoisIizlook through T/C 14:01, 26 February 2021 (UTC) |
- Nope, I'll take it! ^_^ Thanks!! LightandDark2000 🌀 (talk) 16:43, 26 February 2021 (UTC)
- The user is blocked, BTW. ~ 🌀 SCS CORONA 🌀 18:29, 1 March 2021 (UTC)
A sockpuppet of IaiIa123, says the blocking admin.
- The user is blocked, BTW. ~ 🌀 SCS CORONA 🌀 18:29, 1 March 2021 (UTC)
46th issue of Hurricane Herald newsletter
The Hurricane Herald
The Hurricane Herald is the semi-regular newsletter of WikiProject Tropical Cyclones. The newsletter aims to provide in summary the recent activities and developments of the WikiProject, in addition to global tropical cyclone activity. The Hurricane Herald has been running since its first edition ran on June 4, 2006. If you wish to receive or discontinue subscription to this newsletter, please visit the member list. New members will automatically receive this newsletter. This issue of The Hurricane Herald covers all project related events from January 15–February 28, 2021. This edition's editors and authors are MarioJump83, Destroyeraa, HurricaneCovid, CycloneFootball71, HurricaneEdgar, Skarmory, Typhoon2013 (editor's pick for member of the month), and our member of the month, LightandDark2000! Please visit this page and bookmark any suggestions of interest to you. This will help improve the newsletter and other cyclone-related articles. Past editions, including past MoTMs and SoTMs, can be viewed here. | ||||||||||||||||||||||||||||||||||||||||||||
WikiProject Tropical Cyclones: News & Developments
New articles since the last newsletter include:
New GA's include:
I, MarioJump83, the interim coordinator of 2018 Global FT's WPAC squad, feels bad with what is going on as I felt we are taking a step back with the ongoing real-life difficulties regarding important members of our task force. KN2731 had to take a wikibreak because of the compulsory service in Singapore and will likely be gone for two years; Destroyeraa's activities were highly inhibited by multiple illnesses, school exams, "bullying" issues, and series of winter storms this month; Hurricane Noah almost took a two-month-long wikibreak because due to college studies, which Noah is committed to (he also left the WPTC Discord for a couple of months, due to toxicity). I don't really like to take a lot of responsibilities within the 2018 Global FT task force, as I had joined with the intent of helping GA's that involves this year, i.e. like what I did in Cyclone Ava and Cyclone Owen as of now, but with so many of us were forced out of commission due to these problems I mentioned, I and LightandDark2000 had to take much of the responsibility within the task force. Because of this reason, I strongly recommend you, readers of Hurricane Herald, to join this task force to help take pressure off from us. Note that this is not a formal invite, as Wikipedia is free and anyone can edit, but this is what we have to deal with in this current situation, especially because of our real-life problems and commitments. Let's hope that we, including you, can make this through with what we can do!
If you are interested in writing new articles, promoting articles to GA, or helping with the FAC review process for the Global 2018 FT project, please reach out to LightandDark2000 or any other member of the 2018 FT task force. WikiProject To-Do
Storm of the month and other tropical activity for the rest of January and February SoTM for January – Cyclone Eloise Eloise caused numerous disasters throughout numerous countries, specifically, in Madagascar, South Africa, Zimbabwe, Eswatini, and Mozambique. Mozambique was the hardest-hit. In Madagascar, Eloise destroyed 190 homes and caused the death of one person. In South Africa, Eloise caused the deaths of 10 people, four of which were children, in addition to being responsible for making another 7 people go missing. In Zimbabwe, Eloise caused damage and destruction to nearly a thousand homes, some of which were badly affected by Idai two years ago. Three people were also swept away by flooding from Eloise and were presumed to be dead. In Eswatini, over 1,500 people were affected by the storm, two of whom were killed. Eloise also damaged the water system and flooded the gravel roads and low-lying bridges. In Mozambique, the residents compared the cyclone's impacts to Cyclone Idai, which had catastrophically devastated the country two years earlier. This storm caused psychological trauma and mental health crises among the residents of the country. Eloise caused nine deaths in Mozambique, but massive amounts of farmland were flooded, and the storm also damaged over 30,000 houses, the majority of which were destroyed by the storm. 579 classrooms and 86 health centers had to be repaired after the storm. SoTM for February – Cyclone Guambe Guambe caused widespread flooding in Mozambique, which displaced over 27,000 people and worsened the ongoing crisis in the region. Prisoners had to be transferred away from the cyclone because of potential flooding. There were no deaths recorded and damages were unknown, however the worst part of Guambe wasn't there yet. South Africa were also flooded by Guambe, which might have been caused by the secondary low-level circulation center (LLCC) of Guambe. This secondary LLCC had caused Guambe to slow down, which probably had devastating effects on Bazaruto Archipelago National Park's marine life, as 186 Spinner dolphins were probably killed by the storm. After Guambe re-emerged into the Mozambique Channel, no additional damage to human property was reported, thus marking the end of Guambe's impacts on land.
Member of the month (edition) – LightandDark2000 LightandDark2000 joined Wikipedia as an IP editor on May 2, 2009. Although a couple of users encouraged him to make an account early on, he decided to continue editing articles from his IPs for the next few years. He registered his user account in May 2012 and spent another year on Wikipedia as an IP editor, before fully transitioning over to his account in the summer of 2013. He received an invitation to join WPTC in March 2014, which he accepted. Ever since joining WPTC, LightandDark2000 has been a regular editor on tropical cyclone articles and one of Wikipedia's most active rollbackers, putting him on the forefront in the fight against vandals and LTAs, and actively steering the WikiProject out of stagnation. He also defended WPTC from numerous vandals, including the likes of the LTAs IPhonehurricane95 and Lightning Sabre. In late 2014–early 2017, LightandDark2000 largely moved out of WPTC into MILHIST (as well as taking a 3-month WikiBreak in the fall of 2016—due to college work and stress from on-wiki hounding), before returning to WPTC in September 2017, following the devastating landfall of Hurricane Harvey in Texas. From there, LightandDark2000 regularly contributed to tropical cyclone articles, as well as articles on other storms and natural disasters, before taking a series of WikiBreaks in late 2019 through mid-2020, due to college work and real-life activities. However, LightandDark2000 returned in July 2020, just as the extremely-active North Atlantic hurricane season got underway. By the time the last issue of The Hurricane Herald was released, LightandDark2000 had made a full return and was ramping up activity, even as WPTC was beset by a series of problems within its membership, ranging from blocks to stress-induced WikiBreaks. During this time of crisis, LightandDark2000 stepped up very quickly - first, he helped out a number of users who were struggling with personal issues on the WikiProject. Then, he joined 2018 Global FT (currently the Interim Coordinator, with Hurricane Noah and KN2731 stepping aside due to real-life commitments). From there, he conducted his first GA review, which was for Hurricane Beryl. After that, he took on a major role in the writing of the previous issue of The Hurricane Herald, which as of this writing is the biggest issue of Hurricane Herald ever published, at an excess of 50,000 bytes, as well as being the most visually-balanced Hurricane Herald issue since the first issues of Hurricane Herald (if it were to be viewed using a 1920×1080 desktop using Legacy Vector). For these reasons and his contributions to the WPTC in the past, we will finally thank LightandDark2000 for all of his contributions by rewarding him with the Member of the Month for this edition. It's quite sad that he didn't get this award since the restart of Hurricane Herald in late 2018 to this day, but now, he has the opportunity to win the award for the first time. We are hoping to see more from LightandDark2000 in the future. For example, he joined the 2021 Cyclone Cup (and also volunteered to take on the role of a judge, if necessary), a new competition for WPTC members based on the WikiCup! New WikiProject Members since the last newsletter More information can be found here. This list lists members who have joined/rejoined the WikiProject since the release of the last issue. Sorted chronologically.
To our new members: welcome to the project, and happy editing! Feel free to check the to-do list at the bottom right of the newsletter for things that you might want to work on. To our veteran members: thank you for your edits and your tireless contributions!
From January 15 to February 28 no featured article were promoted. From the Main Page: Documents WikiProject related materials that have appeared on the main page from January 15–February 28, 2021 in chronological order. There are currently no featured article candidates. Current assessment table Assessments valid as of this printing. Depending on when you may be viewing this newsletter, the table may be outdated. See here for the latest, most up to date statistics.
Project Goals & Progress The following is the current progress on the three milestone goals set by the WikiProject as of this publishing. They can be found, updated, at the main WikiProject page.
Special thanks to David Roth, Keith Edkins, Hylian Auree and HurricaneSpin In this section, we want to thank these first-generation WPTC members for being able to stay in here for years before 2020. They (David, Keith, Hylian and Spin) are one of greatest content creators in WPTC history, helping to build and shape WPTC for what it is now today. Without them, we don't know if WPTC would be like today. David Roth's expertise, Keith Edkins' maintenance activities, Hylian's and Spin's content creation skill helped a lot in the early days of WPTC and we hope some of us can replicate what they can do in today's WPTC. Member of the month (Editor's Pick) – Typhoon2013 Typhoon2013 first edited Wikipedia in August 2013, and ever since joining Wikipedia, Typhoon2013 has been one of the most prolific editors in Western Pacific basin. Since last November, Typhoon2013 has been working very hard on getting tropical cyclone intensity lists of Western Pacific basin done, lending a hand in creation of named storms lists of C, P, R, and S (alongside finishing List of named storms (T) which I was unable to complete because of college), as well as finishing storm lists of Pacific typhoon seasons from 1980 to 1964. For the efforts Typhoon2013 has done leading to the publishing of this newsletter, I, MarioJump83, as one of many editors of Hurricane Herald, will be picking Typhoon2013 as the Member of the Month (Editor's Pick) and thank him for his contributions to build a bedrock foundation for the rapidly-growing Western Pacific coverage of the Wikipedia. We wish Typhoon2013 best of luck at college! My experience here on Wikipedia - by Destroyeraa Was planned to be published in 44th edition of Hurricane Herald, however due to some issue (and per Destroyeraa's request), I have delayed this opinion piece further into this edition. At this point, I do not want to see this opinion piece getting delayed further into May 2021 as I really, really want this OP, alongside my OP below to finally see the light at the end of the tunnel. MarioJump83! I created my Wikipedia account on January 18, 2020. I seems so long ago. My first edit was creating my user page, and my first mainspace edit was on Hammonton, New Jersey. My first autoconformed edit was on my userpage. By then, I was editing about myself and roads. My first tropical cyclone edit was on January 30, on Tropical Storm Nestor, which got reverted. I also edited about the coronavirus epidemic before it became a worldwide pandemic. I edited List of United States tornadoes in April 2020, but got bitten on the talk page, though my love for tornadoes kept me editing pages. I also began editing numerous cyclone pages, and joined WPTC on May 19. It was sad that no one noticed that I joined, and no one welcomed me on my talk page for five months already. I submitted my first article, Tropical Storm Bertha (2020), which was accepted. I was still rather new, and mistook Chicdat as an admin. It was June already. Still, no one welcomed me. Finally, on June 5, Hurricanehink took notice of my edits and welcome me! Around the same time, I downloaded Twinkle. I found the CSD function very cool, and I admittedly didn't read WP:CSD and misused it. One month later, I met my first real vandal, which turned out to be a Force Thirteen kid who was messing around changing everything to Force Thirteen without leaving a source or an edit summary, which most people will take as vandalism. It turned out to be pretty rough, and did not end well for both of us. I was still learning at that stage, as shown here. After that, my experience here got much better. Perhaps it was the "learning-the-ropes" phase that is the hardest for all Wikipedians. I created and wrote some good articles, with my first being Hurricane Dolores, promoted on September 24. I also developed a good relationship with many of my fellow Wikipedians, including the editors/writers of this newsletter and many other newer and older users. Then came the sock block. I'll not get into much detail about that, though I will be forever indebted to the countless users who vouched for me and who welcomed me back to the community with open arms. Thank you. I am glad to be here today.~ Destroyeraa🌀🇺🇸 My experiences of tropical cyclones and tropical cyclone editing before joining WPTC - by MarioJump83 I planned this OP way back to September 2020, but because of issues with length and college (also even stress - detailed in my previous opinion piece My stress), I decided to delay this opinion piece until now. I also intend to publish this opinion piece alongside Destroyeraa's OP above, thus pushing back the date where I can publish this opinion piece further. Thus I fully apologize for delaying this opinion piece for way too long. I was unable to spend my time on building this opinion piece because of these issues and thus getting this opinion piece complete in time. By the way, this will be the final opinion piece I will write for Hurricane Herald - I'm done with it after two opinion pieces as SMB99thx and two opinion pieces as MarioJump83. It was so much fun creating opinion pieces, but I don't want to have opinion pieces for four straight issues already since the 43rd edition! I'm still editing Hurricane Herald in the future, but not writing opinion pieces any further - ...unless you're inviting me to write an opinion piece in my user talk page, which I'll do my best to comply. Hello, WikiProject Tropical cyclones! I want to tell you about the reasons why I liked and loved tracking tropical cyclones and my experience regarding editing tropical cyclones before I joined this WikiProject. First of all, I have been watching tropical cyclones but on-and-off since 2012. That year, Hurricane Sandy as I remembered it got significant coverage on my country, Indonesia (Badai Sandy). That hurricane was the first tropical cyclone that I had ever known in my life (it's possible that Hurricane Katrina had significant coverage in my country, but I didn't remember anything at all about it), and without it I would never known about tropical cyclones by myself. When that hurricane was about to be finished, I visited the article about 2012 Atlantic hurricane season on Wikipedia, and it was the first article about tropical cyclones that I have ever read on Wikipedia. From that day, my interest on tropical cyclones grew but it was limited to the Atlantic hurricanes only. When 2013 started, if I'm thinking about tropical cyclones I frequently visited 2013 Atlantic hurricane season, and in particular the Seasonal summary section, which drew my eyes into when I didn't edit tropical cyclone articles yet. In November 2013, however, as I'm becoming an uncle of one (now three), Typhoon Haiyan showed up. That typhoon which devastated the Southeast Asian brother country of Philippines caused my interest on tropical cyclones to grow outside of Atlantic hurricanes. Now I'm finally aware of what's happening in Pacific, and it was the first time that I learned that tropical cyclones are everywhere in the world, not just Atlantic. That time, I read 2013 Pacific typhoon season as well as 2013 Pacific hurricane season (I don't remember reading these kinds of articles before that). When I read about it, I also visited 2013 Atlantic hurricane season once again and I was shocked by that it wasn't active! As such, I didn't watch tropical cyclones that much for most of 2014 and 2015. Hurricane Patricia didn't convince me enough to watch tropical cyclones again. In 2016, things changed again that led me to make my first edits on tropical cyclones in Wikipedia. Once Hurricane Matthew came and with it significant coverage on Indonesia that I have never seen since Hurricane Sandy, I finally watched tropical cyclones full-time for the first time. That hurricane was the cyclone that finally got me going for the tropical cyclones (not just the recent seasons, but the older seasons and also SHEM) and my quick-growing interest on tropical cyclones led me to find what made me uncomfortable. That led me to make my first edit on tropical cyclone-related articles in Wikipedia - which was to add Central Pacific to a navigation template about leading tropical cyclones in March 7, 2017. Later that month, I made a second edit, which was to remove a year from a link to Hurricane Omar. These additions are quite "cosmetic" (as said by ChessEric about Hurricane Michelle GA), but soon enough in the next month I found more things that made me more uncomfortable - they are legitimate vandalism. The first edit I made in that month was to revert a vandalism on Hurricane Andrew (I edited it again after that, which was to change mb to mbar). On the next day, I fixed another vandalism in 1954 Atlantic hurricane season. That isn't the end yet, as I found one more vandalism in Hurricane Dennis, and I promptly fixed them. As I'm getting more invested on tropical cyclone articles, I've eventually heard and found out why some articles didn't have (XXXX year) in them - and it is because that they are primary topics. When I see some articles like Hurricane Linda (1997), which I thought they are primary topics (I eventually realized that they are not, and I have not requested moving these articles under WPTC banner ever since), I sought the same treatment in these kinds of articles that I thought was primary topics and thus I requested moves in many of these said articles under that thought. I believed that these requests will garner support by most of the WPTC members (which I thought will think for the same), but never did I know that these requests gained overwhelming opposes, primarily from WPTC members - and they talked to me about it. Of course, I panicked and I have to withdraw some of these nominations. That didn't stop me from editing more WPTC articles, and I started to do these requested moves again soon after. This is probably the most successful things I have ever done through my pre-WPTC membership career in the WPTC realm. After withdrawing some of these nominations, I began to work on a split of 1940–49 Pacific typhoon seasons article by starting the discussion on one in May 14. Two weeks later, as I said before, I started requesting more of these nominations in a batch on May 27 - which was wildly successful (only one of them were failed, and that was Tropical Storm Bret of 1993). In a month after these nominations, and with the consensus for split, I finally worked on the split itself. 1940 Pacific typhoon season and 1949 Pacific typhoon season has been split from the article much more earlier, with Hurricanehink creating an article for the 1940 season in May 23, 2014 and Typhoon2013 split the 1949 section from the article in December 19, 2016. I continued what Hurricanehink and Typhoon2013 has been doing, with copying content from the original article into the respective season articles. First, I reverted them to the original before Hurricanehink merged them. Afterwards, I copied the respective sections from the original into respective articles and removed the respective sections in the original article. From the IDs, you can notice that I did this not in order. Afterwards, I moved the original article into 1941–44 Pacific typhoon seasons without moving it's talk page, which I want to admit was a mistake and made a major ramifications (I even started a RfD, which should not happen) in my attempts to get it back without getting it's talk page removed later in October 2020. Once moving the article, I created redirects for the recently moved article (which includes 1941 Pacific typhoon season, 1942 Pacific typhoon season, 1943 Pacific typhoon season, and 1944 Pacific typhoon season, all of which eventually turned into articles), and quickly changed redirects of the respective storms into the newly restored articles. It was a massive effort that day on June 27, 2017, and the experience that I never forgotten. After that month, I returned into requesting moves once again for the third time, riding on the recent wave of successes. I requested the moves of Hurricane Norman (1978) and Hurricane Liza. Hurricane Liza move request was successful but Norman did not. By that point, the frustration from WPTC members are showing up and by the time I requested moving Typhoon Ida (1958) into Typhoon Ida, I had to be stopped. I also moved Typhoon Pamela (1976) into Typhoon Pamela without any discussion, but you know my intentions by that point, and the move was soon reverted. I had a talk with Yellow Evan regarding these actions, and I soon relented, never requested any moves ever since. I didn't do much for the rest of the year - the most notable moves are moving disambiguation pages Tropical Storm Noru and Tropical Storm Banyan into Typhoon Noru and Typhoon Banyan, respectively. Moving on to the next year, I did not do much once again. Most of the activity that year was working on the most of Tropical Storm Son-Tinh (2018) article. Keep in mind that I plan to return working on that article as a part of 2018 Global FT efforts, and that happened because KN2731 is going to take a break for most of this year. Onto the 2019, I did something that I think planted the seeds for my future MoTM run and vast WPTC growth in 2020. Most of the activity in general involves creating links to the future articles, but I also fixed redirects for most 1930s seasons and created redirects for the rest of 1960s decade for NIO basin. I planned something greater than that, however, but because I had to use my phone and not my laptop (it was broken) I wasn't able to do so. That plan was a factor leading to me joining the WPTC in July 2020 (after I realized about the benefits of joining the WikiProjects) and I began realizing the plan as soon as I got my laptop back. What I did for the most of August 2020 and September 2020 was mostly set in stone back in the previous year, if you don't notice that. If I didn't plan it back in the day, I don't think I would ever got that MoTM (it would have been Destroyeraa most likely). That was a story. It is a long story. It took me pains to get myself established in WPTC, but now here I am. If anyone could have invited me back in the year 2018, I would have rejected it like CyclonicallyDeranged, whom I believe has been driven out of Wikipedia. But coming to this year, I realized the benefits of joining the WikiProjects and now, as said by Hurricanehink, I became a vital editor for WPTC. |
Congrats! Why you don't subscribe to this newsletter? MarioJump83! 06:24, 1 March 2021 (UTC)
- Well, I didn't feel the need to. But, I would definitely like a copy of every issue that I help author, or where my activities are brought up. LightandDark2000 🌀 (talk) 16:55, 2 March 2021 (UTC)
Thanks for making them
This user thanks you for making these amazing userboxes, as they also apply to them. Thank you. |
~ 🌀 SCS CORONA 🌀 16:52, 2 March 2021 (UTC)
- You're welcome! ^_^ LightandDark2000 🌀 (talk) 16:52, 2 March 2021 (UTC)
Regarding Random Forests page
Dear LightandDark2000, Thank you for actively watching for vandalism in Wikipedia pages. I have recently reverted a change made to the Random Forest page, as it was a visible action taken by an author to promote three of his research articles in sections/topics that were not directly related to his work. Indeed, Random Forest is a very broad topic in the machine learning domain, and the citations that this user inserted (including the text of his recent Ph.D. thesis, defended in 2019) are related to extremely specific domains and applications (mainly published in "Journal of Transportation Engineering, Part B: Pavements" and "Journal of Infrastructure Systems"). Therefore, these works cannot be seen as authoritative in the machine learning domain (they also were never cited in the academic domain). I noticed the same pattern of this user on different pages. For this reason, I reverted the edit (i.e. removed the three citations) and reported it as cite spam for further analysis (edit that you have reverted). I am rather new here, so I'm still not used to the right processes/etiquette in this kind of situation, could give us assistance in this case? Thanks a lot 83.137.1.221 (talk) 18:14, 2 March 2021 (UTC)
- I'm sorry, but this isn't my area of expertise. Maybe someone at the WP:Help desk might be able to help out. LightandDark2000 🌀 (talk) 18:18, 2 March 2021 (UTC)
- Thanks for the quick answer. In any case these citations will eventually be removed, I was just surprised by the fact that my cleaning was interpreted as vandalism. I will then simply report this issue on the talk page related to the topic.93.13.173.200 (talk) 18:44, 2 March 2021 (UTC)
TY for the TYs and more!
The Mensch's Barnstar | ||
Thank you for all of the thanking and acknowledging all of the work we all do, also, for being a overall great person! :D WiiBoi (talk) 17:04, 3 March 2021 (UTC) |
- @WiiBoi: No problem! It's always good to let others know that you appreciate their work! ^_^ LightandDark2000 🌀 (talk) 07:55, 4 March 2021 (UTC)
Here is a nice cookie
- @Starman2377: Thanks!! LightandDark2000 🌀 (talk) 02:20, 5 March 2021 (UTC)
A barnstar for you!
The Copyeditor's Barnstar | |
Removed mistakes in articles, so thanks. Dam222 🌋 (talk) 08:28, 9 March 2021 (UTC) |
- No problem! LightandDark2000 🌀 (talk) 08:32, 9 March 2021 (UTC)
Sources needed
Hey Light! I need a few more sources for my sandbox - User:Super Cyclonic Storm Corona/March 2021 Hawaii Floods - that don't repeat the information I already have. I already looked through all news articles. Do you know where to get more sources? ~ 🌀 SCS CORONA 🌀 15:32, 11 March 2021 (UTC)
- Gee, I don't know. You could try using different search phrases on Google. However, it might be best if you wait for Aon Benfield and the NOAA to publish their reports on the natural disasters in the US. Those typically have some more information on the biggest disasters, and they often provide damage estimates as well. The Aon report for this month will come out sometime next month. If you can't find anything else in the meantime, you just might have to sit tight until further reports on the event are released. LightandDark2000 🌀 (talk) 21:35, 11 March 2021 (UTC)
- Ok, thanks! Meanwhile I'll be working on Winter Storm Xylia. ~ 🌀 SCS CORONA 🌀 13:06, 12 March 2021 (UTC)
- Okay. BTW, HurricaneCovid has a draft for Xylia, since Xylia is expected to become a major winter storm for the Rockies, but his draft barely has anything in it, last I checked. LightandDark2000 🌀 (talk) 17:59, 12 March 2021 (UTC)
- Ok, thanks! Meanwhile I'll be working on Winter Storm Xylia. ~ 🌀 SCS CORONA 🌀 13:06, 12 March 2021 (UTC)
A barnstar for you!
The Editor's Barnstar | ||
Regarding the Sleepinthestars situation, I honestly did something wrong and probably disruptive for the WikiProject. As I want to admit, I am on recruiting pitch back in March 10, which led to Tc06cimaron and Floridaball officially joining the project, but also led to dumb decisions like SR and Sleep (which, if you want to acknowledge it, is the main editor of tropical cyclone articles in Ukrainian Wikipedia). I am giving you barnstar for your handling in this situation, and I am also going to quit from recruiting efforts in WPTC (including resisting these efforts if necessary). MarioJump83! 01:34, 13 March 2021 (UTC) |
- I also want to say that your talk page is full of awards, cookies (which is food WikiLove) and barnstars. You may want to archive it in a separate archive designed for it. MarioJump83! 01:34, 13 March 2021 (UTC)
- Thanks! I know that I can sound a little harsh at times, but that kind of stuff has to be dealt with. I just don't want to see things get out of our control, or more of our fellow editors getting in trouble. Thanks for the barnstars, though. I think you'll learn from experience. You can take break from recruiting if you want, but you can return whenever you feel that you're ready. BTW, I will archive my talk page soon. I was going to do it in back January, but I decided to leave it open for a much longer period of time after I saw all the support that was pouring in from you guys, during my operation and the stuff that followed. I decided that I might as well leave it open until things calm down a little on my talk page. LightandDark2000 🌀 (talk) 02:16, 13 March 2021 (UTC)
Another barnstar for you!
The Meteorology Barnstar | ||
While I am on the edge of my stress right now, you are going to be the first recipient of this barnstar. MarioJump83! 02:04, 13 March 2021 (UTC) |
Disambiguation link notification for March 13
An automated process has detected that when you recently edited Floods in the United States: 2001–present, you added a link pointing to the disambiguation page Kuai.
(Opt-out instructions.) --DPL bot (talk) 06:22, 13 March 2021 (UTC)
Because you thanked me
LightandDark2000, you thanked me for one of my recent edits, so here is a heart-felt... YOU'RE WELCOME! It's a pleasure, and I hope you have a lot of fun while you edit this inspiring encyclopedia phenomenon! JennilyW (talk) |
05:04, 14 March 2021 (UTC) JennilyW (talk) 05:04, 14 March 2021 (UTC)
- No problem! LightandDark2000 🌀 (talk) 05:05, 14 March 2021 (UTC)
A pi for you!
Just to celebrate π day, here's a pi for you! Tfess up?or down? 19:55, 14 March 2021 (UTC) |
- That looks fun. LOL! XD LightandDark2000 🌀 (talk) 04:09, 15 March 2021 (UTC)
A barnstar for you!
The Defender of the Wiki Barnstar | |
You did a great job defending from vandalism, among with the collection of all your other banstars, I believe you deserve this. Have fun making a plaque for all of these. Opkiller82 (talk) 04:07, 15 March 2021 (UTC) |
- Thanks! You're doing a great job yourself. LightandDark2000 🌀 (talk) 04:09, 15 March 2021 (UTC)
Welcome!
I saw you joined the Current Events WikiProject, so welcome! ~ 🌀 SCS CORONA 🌀 17:26, 15 March 2021 (UTC)
Some Masala Dosa For you!
Masala Dosa | |
Masala dosai or masale dose or masaldosa is a variation of the popular South Indian dosa, which has its origins in Tuluva Mangalorean cuisine of Karnataka. It is made from rice, lentils, potato, fenugreek, and curry leaves, and served with chutneys and sambar. It is popular in South India, it can be found in all other parts of the country and overseas. In South India, preparation of masala dosa varies from city to city.
This is my favorite food. I'm not sure if you would like it too, but I'm giving this to you as appreciation for all your thanks, my notifications are filled with them! |
- Ooohh!! That looks good! (I've never had one before, though.) And you're welcome! ^_^ LightandDark2000 🌀 (talk) 17:42, 16 March 2021 (UTC)
A barnstar for you!
The Random Acts of Kindness Barnstar | |
Thanks for the birthday cake! Black Forest is my favorite! ~ 🌀 SCS CORONA 🌀 18:02, 19 March 2021 (UTC) |
- Aw...You're welcome! And I didn't know that Black Forest was your favorite, but I'm happy to see that you enjoy it! (And I got it spot-on, too.) :) LightandDark2000 🌀 (talk) 18:04, 19 March 2021 (UTC)
The Military Barnstar
I really don't know what to say, thanks a lot for the kind words mate, I have tried my best always and although I have partially stepped away/retired from Wikipedia I hope I will be able to help in the future as well. Thanks once again! :) EkoGraf (talk) 15:54, 21 March 2021 (UTC)
- Aw, no problem! You've done a great job here. I just wanted to thank you for everything. LightandDark2000 🌀 (talk) 13:27, 22 March 2021 (UTC)
A barnstar for you!
The Special Barnstar | |
Thank you so much for all that you do, like reverting vandalism, making great edits, being so kind, and being supportive of other editors. Thanks for making Wikipedia such a great place! 🌀CycloneFootball71🏈 |sandbox 14:49, 22 March 2021 (UTC) |
- Thank you so much! This really means a lot to me. LightandDark2000 🌀 (talk) 19:52, 22 March 2021 (UTC)
- No problem! Glad you like it! :-) 🌀CycloneFootball71🏈 |sandbox 20:12, 22 March 2021 (UTC)
A cupcake for you!
Sorry to see you've sprained your ankle. I had that happen to me 3 years ago, not a pleasant experience. Hope you get better soon. ~ 🌀 SCS CORONA 🌀 16:40, 23 March 2021 (UTC) |
- I second this cupcake. 🌀HurricaneCovid🌀 (contribs) 16:41, 23 March 2021 (UTC)
- Like +1 I third? This cupcake. I have this happen to me too many times to count, so I know your pain. Luckily it will eventually heal. Stay strong. 🌀CycloneFootball71🏈 |sandbox 17:07, 23 March 2021 (UTC)
- Thank you all for your support. I am really touched. Hopefully, I'll make a quick recovery. This really sucks. LightandDark2000 🌀 (talk) 21:43, 23 March 2021 (UTC)
- Hoping for a quick recovery for you too. I know your pain, but it will get better. Stay safe... - 🌀CycloneFootball71🏈 |sandbox 17:56, 25 March 2021 (UTC)
- Thank you all for your support. I am really touched. Hopefully, I'll make a quick recovery. This really sucks. LightandDark2000 🌀 (talk) 21:43, 23 March 2021 (UTC)
- Like +1 I third? This cupcake. I have this happen to me too many times to count, so I know your pain. Luckily it will eventually heal. Stay strong. 🌀CycloneFootball71🏈 |sandbox 17:07, 23 March 2021 (UTC)
Userboxes
Hello L&D2000, I was wondering if you could help me with something regarding a userbox I recently created. Now, I ask you as I have seen you make user-boxes before, and so I though you could help me out. I want to add it to the Wikipedia talk:Userboxes/New Userboxes page, but I am not sure how to do the formatting seen on the page, like this: { { User:Tcr25/Userbox/User Hates DST } } so I was wondering if you could help me figure out how to make the link like that? Or am I just dumb and it is simply { { User:CycloneFootball71/UBX } } (without the spaces of course) Any help would be much appreciated. Thank you so much Sorry if that is confusing. -🌀CycloneFootball71🏈 |sandbox 23:04, 23 March 2021 (UTC) My UBX:
Breathe Peace of Mind | This User's favorite album is Peace of Mind By Breathe |
- Hi! I think the issue here is that you're missing the following snippet of code below your userbox:
<noinclude>
{{Documentation}}
</noinclude>
Try adding this below the rest of the code for your userbox. Let me know if that works. BTW, I would strongly recommend renaming your userbox to something more specific (specifically, adding a / dash after "UBX" and adding a more specific title), because it's pretty general right now, especially if you plan on making more userboxes. LightandDark2000 🌀 (talk) 23:12, 23 March 2021 (UTC)
- Thanks for the help. I added on the code like you said, but I am having a bit of confusion on where to place everything. I know it says where to add categories, but I am not very good at reading code or doing things like that. Really sorry for taking up you time, I am trying to learn all of the hidden aspects of Wikipedia still.
{{Documentation subpage}}
<!-- Add categories where indicated at the bottom of this page and interwikis at Wikidata -->
== Usage ==
<includeonly>{{sandbox other||
<!-- Categories below this line; interwikis at Wikidata -->
}}</includeonly>
🌀CycloneFootball71🏈 |sandbox 23:40, 23 March 2021 (UTC)
- Well, I think you're supposed to find the appropriate user categories and add them within the "noinclude" tags. You can see this userbox I made as an example. Hope this helps. :) LightandDark2000 🌀 (talk) 23:49, 23 March 2021 (UTC)
- ohhh that makes sense, and it makes a lot more sense on what I was doing wrong, as my userbox code isn't formatted the same way. That definitely helps a lot, thank you! 🌀CycloneFootball71🏈 |sandbox 00:14, 24 March 2021 (UTC)
- No problem! :) LightandDark2000 🌀 (talk) 00:16, 24 March 2021 (UTC)
- Really sorry, but I have one last question. I was able to get categories and fix the userbox, so how do I get the userbox on my page and have the category show up? 🌀CycloneFootball71🏈 |sandbox 00:38, 24 March 2021 (UTC)
- Assuming the categories were inserted correctly, they should show up on your userpage if you add the userbox to your page. If it's still not showing up, there's probably an issue with how you're incorporating the categories. LightandDark2000 🌀 (talk) 00:46, 24 March 2021 (UTC)
- Oh okay, thank you. I think I figured it out. Thank you so much for your advice with this, it means a lot! 🌀CycloneFootball71🏈 |sandbox 00:57, 24 March 2021 (UTC)
- Assuming the categories were inserted correctly, they should show up on your userpage if you add the userbox to your page. If it's still not showing up, there's probably an issue with how you're incorporating the categories. LightandDark2000 🌀 (talk) 00:46, 24 March 2021 (UTC)
- Really sorry, but I have one last question. I was able to get categories and fix the userbox, so how do I get the userbox on my page and have the category show up? 🌀CycloneFootball71🏈 |sandbox 00:38, 24 March 2021 (UTC)
- No problem! :) LightandDark2000 🌀 (talk) 00:16, 24 March 2021 (UTC)
- ohhh that makes sense, and it makes a lot more sense on what I was doing wrong, as my userbox code isn't formatted the same way. That definitely helps a lot, thank you! 🌀CycloneFootball71🏈 |sandbox 00:14, 24 March 2021 (UTC)
A Barnstar for you!
The Good Article Barnstar | |
Thanks for working on Tropical Storm Rolf's article. Dam222 🌋 (talk) 07:50, 24 March 2021 (UTC) |
- Thank you so much! I really appreciate this! LightandDark2000 🌀 (talk) 07:52, 24 March 2021 (UTC)
A cup of tea for you!
I'm sorry to see that you're miserable. Tea always helps me feel better, and I hope that it does for you too. CodingCyclone! 🌀 📘 17:49, 25 March 2021 (UTC) |
- Thank you so much! I really appreciate your support. I have an injured ankle to deal with in addition to a persistent stomach pain (started yesterday), so I'm feeling like crap. LightandDark2000 🌀 (talk) 17:53, 25 March 2021 (UTC)
Whoa.
Hey, IDK if you know this or not, but you are the 1433th most active editor of all time on the wiki. ~~ 🌀𝚂𝙲𝚂 𝙲𝙾𝚁𝙾𝙽𝙰🌀 18:12, 25 March 2021 (UTC)
- Well, I knew that I was somewhere up around the 1,400s zone. I suppose that's what I get for my years of activity. BTW, if you want to know how active I really am, you need to tack on another 3 years and 6,500+ more edits, from back when I used to be an IP editor. ^_^ LightandDark2000 🌀 (talk) 21:16, 25 March 2021 (UTC)
- Wow. Y'know, you're pretty close to Hurricanehink and Cyclonebiskit. ~~ 🌀𝚂𝙲𝚂 𝙲𝙾𝚁𝙾𝙽𝙰🌀 11:55, 26 March 2021 (UTC)
A barnstar for you!
The Writer's Barnstar | ||
For singlehandedly writing articles for PTC 10 and Hurricane Pali. Great job! 🌀HurricaneCovid🌀 (contribs) 12:21, 26 March 2021 (UTC) |
- Thanks! LightandDark2000 🌀 (talk) 18:29, 26 March 2021 (UTC)
no pings, please
I don't know why you pinged me to close an RFC, but please don't do that again. I'm mostly inactive due to my parents' health issues and hospice care, but even if I weren't, I'm well aware of where to find the overdue RFCs if I wish to start closing some. Thanks. Katietalk 15:14, 26 March 2021 (UTC)
- Oh sorry. I was completely unaware of those issues. I hope they get well soon. I pinged you because I saw you as a trusted admin, for the record. LightandDark2000 🌀 (talk) 18:28, 26 March 2021 (UTC)
- You seem to have a habit of doing this. I noticed that you received a similar complaint on meta:SRG shortly after receiving the complaint above. I think it'd be helpful to remember that very few issues on Wikipedia truly require urgent attention, so to be respectful of other editors' time, it's usually not necessary to ping specific admins and stewards for tasks that could be resolved by other admins and stewards. Mz7 (talk) 04:39, 27 March 2021 (UTC)
- Sorry. I just hate seeing backlogs. Especially when stuff like reports on active vandals/LTAs go unaddressed for hours on end at AIV (usually during the inactive hours of the day). LightandDark2000 🌀 (talk) 05:53, 27 March 2021 (UTC)
- You seem to have a habit of doing this. I noticed that you received a similar complaint on meta:SRG shortly after receiving the complaint above. I think it'd be helpful to remember that very few issues on Wikipedia truly require urgent attention, so to be respectful of other editors' time, it's usually not necessary to ping specific admins and stewards for tasks that could be resolved by other admins and stewards. Mz7 (talk) 04:39, 27 March 2021 (UTC)
Disambiguation link notification for March 27
An automated process has detected that when you recently edited List of natural disasters in the United States, you added a link pointing to the disambiguation page Georgia.
(Opt-out instructions.) --DPL bot (talk) 06:16, 27 March 2021 (UTC)
April 2021 WikiProject Military History Reviewing Drive
Hey y'all, the April 2021 WikiProject Military History Reviewing Drive begins at 00:01 UTC on April 1, 2021 and runs through 23:59 UTC on April 31, 2021. Points can be earned through reviewing articles on the AutoCheck report, reviewing articles listed at WP:MILHIST/ASSESS, reviewing MILHIST-tagged articles at WP:GAN or WP:FAC, and reviewing articles submitted at WP:MILHIST/ACR. Service awards and barnstars are given for set points thresholds, and the top three finishers will receive further awards. To participate, sign up at Wikipedia:WikiProject_Military_History/April 2021 Reviewing Drive#Participants and create a worklist at Wikipedia:WikiProject Military history/April 2021 Reviewing Drive/Worklists (examples are given). Further details can be found at the drive page. Questions can be asked at the drive talk page. MediaWiki message delivery (talk) 17:25, 31 March 2021 (UTC)
Rollback Barbat
I'm working and unable to fix recent changes to the barbat article, but they were done at the same time as the recent changes to the oud article, that you rolled back. Would you mind rolling back the recent changes to barbat? The author seems to be fixated on making the instrument an Iranian only instrument, and sources don't support that. If not, I get to it tonight. Best wishes, Jacqke (talk) 19:40, 31 March 2021 (UTC)
- Done. LightandDark2000 🌟 (talk) 19:48, 31 March 2021 (UTC)
April 2021
This is your April Fools' warning; if you continue to contribute constructively to Wikipedia, you may be showered with barnstars without further notice. HAHA! Happy April Fools' Day! XD Anyway, nice new signature :) CodingCyclone! 🌀 📘 02:30, 1 April 2021 (UTC)
- HAHAHA!!! LOL!! Good one! Happy April Fools' Day to you as well! I shall continue to "edit constructively." Hehe! ^_^ LightandDark2000 🌟 (talk) 02:39, 1 April 2021 (UTC)
hhelibebcnofnenamgalsipsclarkcasctivcrmnfeconicuzngageassebrkrrbsryzrnbmotcrurhpdagcdinsnsbteixecsba
April Fools!!!!!!! P.S. The headline is just the first 56 atomic symbols of the periodic table all lowercased and with no spaces. Tfess up?or down? 04:01, 1 April 2021 (UTC) And my attempts at bringing about April Fools is, well, in shambles.
A barnstar for you!
The Barnstar of Good Humor | |
LOL! That April Fools' joke was amazing! ~~ 🌀𝚂𝙲𝚂 𝙲𝙾𝚁𝙾𝙽𝙰🌀 22:42, 2 April 2021 (UTC) |
Boom Star
Hey, hope all is good. I just wanted to let you know that I saw these articles about the boom star was expected in 2022. Here they are: https://www.discovermagazine.com/the-sciences/two-stars-wont-collide-into-a-red-nova-in-2022-after-all and https://www.sciencealert.com/kic-9832227-cygnus-binary-star-collision-prediction-was-wrong-data However, I might not be thinking of the same one on your userpage. I wanted to come here and let you know about it before I go and just edit your page without permission. Thanks - 🌀CycloneFootball71🏈 |sandbox 05:14, 6 April 2021 (UTC)
- Honestly, it probably is the same one. I've gone ahead and taken it off of my userpage. Wow. That really is a bummer. And really, a typo?!? Of all things...Ugh. BTW, I am feeling better now. I got an infection sometime last week, which ended up developing into a sinus infection yesterday, after my immune system was weakened by recent events (stress, the heatwave, and sleep deprivation). Probably a Cold. I am feeling much better now, though, on all fronts. :) LightandDark2000 🌀 (talk) 05:23, 6 April 2021 (UTC)
- I was very dissapointed as well, I was looking forward to being able to see it. Glad to hear you're feeling better, sorry that you had all of that stuff happen though. I hope your ankle is feeling better too. 🌀CycloneFootball71🏈 |sandbox 13:50, 6 April 2021 (UTC)
Have a nice crispy cookie!
This cookie will cheer you up. It is warm and crisp! Floridaball ;). 17:03, 7 April 2021 (UTC) |
- Thank you so much! I really appreciate it. Yum! LightandDark2000 🌀 (talk) 19:09, 7 April 2021 (UTC)
- You're welcome! Floridaball ;). 22:28, 7 April 2021 (UTC)
Kullanıcı İsmi separation line
Seems Kullanıcı İsmi added the separation line to dozens of articles. So it wouldn't be just me, and knowing you are of the same mind, could you remove the line in the other articles where I haven't removed yet? I removed over half of where he added already. Here are the ones that still need removing. [6][7][8][9][10][11][12][13][14][15][16][17][18][19][20][21][22][23][24] Also, could you keep an eye on him as well so he doesn't do it again? Seems he's a problematic editor who has been blocked three times in just the three months he has been editing. EkoGraf (talk) 19:18, 7 April 2021 (UTC)
- I can't say that I will be able to stop him, disruptive though it may be. This may require admin attention if it continues. However, I'm averse to going to ANI. That place has a rather foul taste in my mouth, and I would rather avoid more drama if it can be helped. I think those articles are also covered by 1RR, which is worth considering. HE should be notified, if he hasn't yet been already. And if he continues, a block is probably necessary. Especially given his past behavior. LightandDark2000 🌀 (talk) 19:21, 7 April 2021 (UTC)
- I will keep an eye on him as well. EkoGraf (talk) 19:24, 7 April 2021 (UTC)
- I finished it up all by myself on the remaining articles, but if any future reverts of his disruptive edits are needed I think your help would be great. Thanks in advance! EkoGraf (talk) 19:58, 7 April 2021 (UTC)
- Seems the editor has been indefinitely blocked and the issue resolved. EkoGraf (talk) 20:26, 7 April 2021 (UTC)
- Yeah. I took a look through his block log and some of his recent edits and finally had enough. I just went and reported him. LightandDark2000 🌀 (talk) 20:27, 7 April 2021 (UTC)
- Seems the editor has been indefinitely blocked and the issue resolved. EkoGraf (talk) 20:26, 7 April 2021 (UTC)
- I finished it up all by myself on the remaining articles, but if any future reverts of his disruptive edits are needed I think your help would be great. Thanks in advance! EkoGraf (talk) 19:58, 7 April 2021 (UTC)
- I will keep an eye on him as well. EkoGraf (talk) 19:24, 7 April 2021 (UTC)
Discussion on the inclusion of Iraq in the 'Arab states of the Persian Gulf' article
Hey there @LightandDark2000! I saw that you're a member of WikiProject Western Asia. Just wanted to notify you that I have opened up a discussion on whether Iraq should be included in the ASPG article. In the talk page I've organized a short history and research on the subject. And opened a discussion on the issue. If you're interested please feel free to join, we would love for neutral third party opinion on the matter. Cheers! — ♾️ Contemporary Nomad (💬 Talk) 07:18, 20 April 2021 (UTC)
Thanked for 2 edits
I noticed that you thanked me for 2 of my edits. While it's not really all that significant, I would like to tank you for thanking more than just one of my edits. It's rare that I see the same editor thank more than one of my edits. I would give you a barn star but I can't figure out how at the moment but once I do I will gladly give you one. Blaze The Wolf | Proud Furry and Wikipedia Editor (talk) 18:08, 21 April 2021 (UTC)
- No problem! BTW, you can give most barnstars using the WikiLove tab near the Twinkle options tab, on the upper right side of the page. It's marked by the heart symbol. LightandDark2000 🌀 (talk) 18:13, 21 April 2021 (UTC)
- Eh, I'm here for the same thing. Thank you for the thanks :) --The Right 'Orrible (talk) 21:59, 21 April 2021 (UTC)
A kitten for you!
I really appreciate your thanks on some of my edits! Your kindness really made my day. Thank you for sharing the WikiLove, and here is some for you!
TheLastClassicist1750 (talk) 07:27, 22 April 2021 (UTC)
- Thanks! LightandDark2000 🌀 (talk) 16:14, 17 May 2021 (UTC)
A barnstar for you!
The Original Barnstar | |
Thanks for stopping vandalism :) Justiyaya (talk) 07:33, 24 April 2021 (UTC) |
Thanks! LightandDark2000 🌀 (talk) 08:49, 24 April 2021 (UTC)
South Atlantic Tropical Cyclone
Hi. I am having an issue on South Atlantic tropical cyclone. An IP is attempting to start another edit war and replace the timeline that was removed. I have reverted him but I am trying to refrain from surpassing 3rr. It is obviously Td30W (talk · contribs) with exactly the same wording and tone in their edit summaries, and the fact that they are so adamant in such a poor table. I am not sure how to properly do it, so could you please help me report the IP as a sockpuppet or whatever they are? Thanks 🌀CycloneFootball71🏈 |sandbox 14:38, 24 April 2021 (UTC)
- Okay, I figured out how to open a sock investigation. Here it is: Wikipedia:Sockpuppet investigations/ Td30W. 🌀CycloneFootball71🏈 |sandbox 14:48, 24 April 2021 (UTC)
- @CycloneFootball71: Sorry for the late reply. The report should be at Mazum24, because this is clearly the same LTA. The newer report should be merged into the older one. Also, this LTA has been at this for a while. I'll report the IPs as well. LightandDark2000 🌀 (talk) 01:39, 25 April 2021 (UTC)
- Okay Thanks. Both the IP's were blocked, and the investigation was archived, so for now things appear to have simmered down. Thanks for replying and giving some suggestions and helping out. 🌀CycloneFootball71🏈 |sandbox 03:55, 25 April 2021 (UTC)
- @CycloneFootball71: Sorry for the late reply. The report should be at Mazum24, because this is clearly the same LTA. The newer report should be merged into the older one. Also, this LTA has been at this for a while. I'll report the IPs as well. LightandDark2000 🌀 (talk) 01:39, 25 April 2021 (UTC)
A barnstar for you!
The Random Acts of Kindness Barnstar | |
Thank you for telling me not to overlink. I genuinely appreciate it. Gummycow moomilk 18:39, 28 April 2021 (UTC) |
- Aw, thanks! No problem! Just wanted to help you understand how things work here. BTW, I used to overlink when I was a newbie here, though not to the same extent. LightandDark2000 🌀 (talk) 18:41, 28 April 2021 (UTC)
You thanked me!
You thanked my addition of the opinion piece about Destroyeraa. This really means a lot to me, and not because it's the first time I've been thanked (it certainly is not). It's because recently, you have vouched for Destroyeraa in discussions, and that makes it feel like it came from Destroyeraa himself. 🐔 Chicdat Bawk to me! 10:17, 29 April 2021 (UTC)
- No problem! I feel that people should be appreciated for their edits. And yeah, many of us on WPTC do see Destroyeraa as a friend. He's actually a close friend of mine now. LightandDark2000 🌀 (talk) 17:50, 30 April 2021 (UTC)
Nomination of IC Markets for deletion
The article will be discussed at Wikipedia:Articles for deletion/IC Markets (2nd nomination) until a consensus is reached, and anyone, including you, is welcome to contribute to the discussion. The nomination will explain the policies and guidelines which are of concern. The discussion focuses on high-quality evidence and our policies and guidelines.
Users may edit the article during the discussion, including to improve the article to address concerns raised in the discussion. However, do not remove the article-for-deletion notice from the top of the article. Lesliechin1 (talk) 07:31, 30 April 2021 (UTC)
A barnstar for you!
The Special Barnstar | |
I just want to thank you for all that you have done. For helping me through really difficult parts of my life, for convincing Destroyeraa to come back to WP, for making such great edits, and articles, and for reverting vandalism, and making Wikipedia a better place. Thank you so much, you are a great friend, keep up the amazing work! 🌀CycloneFootball71🏈 |sandbox 02:57, 1 May 2021 (UTC) |
- Thank you so much! No problem! I'm just trying to make the world a better place. And that means helping out my friends. :) LightandDark2000 🌀 (talk) 03:02, 1 May 2021 (UTC)
- no problem, thank you again though for all that you've done. I am glad Wikipedia has people like you to make the world a better place. Thank you for being so kind and for being a good friend. 🌀CycloneFootball71🏈 |sandbox 06:00, 1 May 2021 (UTC)
47th issue of Hurricane Herald newsletter
The Hurricane Herald
The Hurricane Herald is the semi-regular newsletter of WikiProject Tropical Cyclones. The newsletter aims to provide in summary the recent activities and developments of the WikiProject, in addition to global tropical cyclone activity. The Hurricane Herald has been running since its first edition on June 4, 2006. If you wish to receive or discontinue subscription to this newsletter, please visit the member list. New members will automatically receive this newsletter. This issue of The Hurricane Herald covers all project related events from March 1–April 30, 2021. This edition's editors and authors are MarioJump83, Chicdat, Super Cyclonic Storm Corona, HurricaneEdgar, Dam222, AwesomeHurricaneBoss, LightandDark2000, LowercaseGuy (one of the editor's picks for Member of the Month), and our Members of the Month, CycloneFootball71, and CodingCyclone! Please visit this page and bookmark any suggestions of interest to you. This will help improve the newsletter and other cyclone-related articles. Past editions, including past MoTMs and SoTMs, can be viewed here. | ||||||||||||||||||||||||||||||||||||||||||||
WikiProject Tropical Cyclones: News & Developments
New articles since the last newsletter include:
New GA's include:
New A-Class articles include Cyclone Leon–Eline and Hurricane Olivia (2018). Member of the month (Editor's Pick) – Akbermamps and LowercaseGuy In this edition of Hurricane Herald, I (MarioJump83, one of the Hurricane Herald editors) am going to pick Akbermamps and LowercaseGuy. Both of them contributed to nearly all of the new articles since the publishing of the last issue (and also they contributed to the last issue itself). All of these articles primarily covered the Western Pacific basin, but also they worked on missing Tropical cyclones in xxxx articles and Southern Hemisphere articles. They both were driving factors in some of the greatest growth the WPTC has ever seen since Issues 42, 43, and 44. Both of them are hard workers, who remain civil, and treat others with kindness, despite hardships. Akbermamps also has reverted many nonconstructive edits from many different articles, plus they have made many great edits to tropical cyclone articles, as said above. LowercaseGuy also has made many great edits, per above, plus they have kept the newsletter up to date with all of the new article creations, new GA's, and A-class articles within the project. Because of this, I can only say that I am very proud of them!
None during this period.
Since the last issue of this newsletter, I have noticed that there is an uptick of activity involving 2018 Global FT topic recently. Hurricane Noah came back from almost-retirement, then afterwards improved Hurricane Olivia (2018) into A-class, 2018 Pacific hurricane season within striking distance of it and Timeline of the 2018 Pacific hurricane season potentially became the second featured list we are going to have this year. Meanwhile, I have been focusing all of my efforts in WPTC at improving Cyclone Owen, by Chicdat, into GA status and end all drama between him and all other WPTC editors. Two MoTMs that I have personally picked, Akbermamps and LowercaseGuy, joined the fray (not joining us officially) and improved some 2018 Pacific typhoon season articles that I have created, including the creation of both two articles listed above (and as of right now, Akbermamps is building up Timeline of the 2018 Pacific typhoon season article in his sandbox). I'm very glad to see this happening and I hope this newly found activity could be kept up in the next two months. During these months, I am hoping that Noah might make efforts at improving Hurricane Bud (2018) towards FA eventually. MarioJump83!
If you are interested in writing new articles, promoting articles to GA, or helping with the FAC review process for the Global 2018 FT project, please reach out to LightandDark2000 or any other member of the 2018 FT task force. WikiProject To-Do
Storms of the month and other tropical activity for March and April SoTM for March – Cyclone Niran Cyclone Niran originated from a developing tropical low off the coast of Queensland on February 27. Afterward, the system slowly began to strengthen, while making a slow clockwise loop, bringing heavy flooding to parts of Queensland. On March 1, the system strengthened into a Category 1 tropical cyclone on the Australian region basin scale, and was given the name Niran by the BoM. On March 3, Niran began to undergo rapid intensification as it began accelerating away from the Australian coast, towards the southeast. On March 5, Niran crossed over into the FMS's area of responsibility, in the South Pacific basin. Soon afterward, the cyclone reached its peak intensity as a Category 5 tropical cyclone on both the Australian region scale and the Saffir–Simpson scale (SSHWS), with maximum 10-minute sustained winds of 205 km/h (125 mph), maximum 1-minute sustained winds of 260 km/h (160 mph), and a central minimum pressure of 931 millibars (27.5 inHg). Several hours later, Niran underwent an eyewall replacement cycle and encountered wind shear, which caused the storm to begin weakening. The storm continued moving towards the southeast at a rapid pace, and on March 6, the storm struck the island of Grande Terre in New Caledonia, as a Category 3-equivalent tropical cyclone on the SSHWS, although the storm's eye stayed offshore. On March 6, Niran transitioned into an extratropical cyclone, and two days later, Niran was absorbed into another larger extratropical storm to the south. Niran caused at least $200 million (2021 USD) in damages, the vast majority of which came from banana crop damage in Queensland. No deaths were reported from the storm. SoTM for April – Cyclone Seroja On March 19, the BoM began monitoring a developing tropical low to the south of Timor, which they designated as 22U. On April 3, the system fully developed into a tropical low. For the next couple of days, the system made a slow counterclockwise loop over a part Indonesia and over Timor, gradually strengthening as it did so, causing torrential floods that killed at least 229 people. On April 4, the system strengthened into a Category 1 tropical cyclone on the Australian region scale and was named Seroja by TCWC Jakarta. On April 5, Seroja began moving southwestward, away from Indonesia. The storm encountered wind shear during this time, but the storm maintained tropical cyclone intensity. On April 7, Seroja began closely interacting with Tropical Low 23U to the northeast, which later became Cyclone Odette, as a result of the Fujiwhara effect. The two storms began closely interacting on April 8, as the two storms drew closer to each other. The interaction initially caused both storms to weaken, though Seroja eventually restrengthen and 23U strengthened into Tropical Cyclone Odette later that day. However, soon afterward, Seroja became the stronger storm and begen to absorb Odette into its circulation. On April 10, Seroja absorbed Odette, before turning to the southeast and strengthening again. The system continued stregthening up until landfall, and the system made landfall on April 12 near Gregory, Western Australia, at peak intensity, as a Category 3 severe tropical cyclone on the Australian region scale and a Category 1-equivalent tropical cyclone on the Saffir–Simpson scale. Afterward, Seroja weakened as it moved inland, and the system transitioned into an extratropical storm, before emerging into the Great Australian Bight. Later that day, Seroja was absorbed by a larger extratropical cyclone to the south. Seroja killed at least 229 people and left another 102 missing, making it the third-deadliest tropical cyclone recorded in the Australian region basin. The storm also caused over $490.7 million (2021 USD) in damages.
Member of the month (edition) – CycloneFootball71 and CodingCyclone In this edition of Hurricane Herald, we present CycloneFootball71 and CodingCyclone as the Members of the Month. Both users joined Wikipedia and WPTC in the year 2020, and they helped us navigate into a better place during the COVID-19 pandemic and during the WPTC conflicts in 2020 and 2021. Their participation lifted and maintained our spirits during the tense situations and what's happening in the world. CycloneFootball71 is the kindest WPTC member we have ever seen, actively giving out barnstars and writing out statements that can be considered as "motivational", never targeting anyone, while also making contributions to articles, and participating in talk-page discussions, and occasionally, reverting vandalism. CodingCyclone, meanwhile, gave Wiki-project Tropical Cyclones the first featured list in years, and she helps out with wording, current cyclones, and other neglected timelines, and all around is kind, and thoughtful to everyone within the Wikipedia community. She is someone who has matured to become a great, and experienced editor here. We thank her for all of her contributions, and hope she continues to keep up the great work, and kindness. Unfortunately, 2020 was not a kind year for the two of them, particularly for CycloneFootball71, as he suffered from numerous illnesses, a few injuries, the loss of a friend (offwiki) and he retired (though he came back, thankfully) numerous times; these troubles even continued into 2021. Meanwhile, CodingCyclone stayed, but she entered a semi-WikiBreak, due to real life matters she had to attend to. However, both of them are editing at full speed now, and helped us realize what 2021 should be, full of hope and a better year than 2020 was. New WikiProject Members since the last newsletter More information can be found here. This list lists members who have joined/rejoined the WikiProject since the release of the last issue. Sorted chronologically.
To our new members: welcome to the project, and happy editing! Feel free to check the to-do list at the bottom right of the newsletter for things that you might want to work on. To our veteran members: thank you for your edits and your tireless contributions! Thank you, JavaHurricane JavaHurricane, one of the prominent Wikipedia rollbackers since 2019, decided to quit WikiProject Tropical cyclones in April 7, 2021 after series of arguments regarding how the merger of Tropical storms Amanda and Cristobal was handled (though this was later resolved). This followed a series of events that included numerous edit wars, hostile interactions (involving both members and non-members of the Weather WikiProjects), incompetence issues, and trouble dealing with a number of serial vandals. These issues added on more and more stress to some of our members, with the botched handling of the Amanda/Cristobal merger being the last straw, which culminated in several WPTC members, especially the younger ones, to leave the project. Destroyeraa decided to fully retire from Wikipedia, but LightandDark2000 managed to get him consider rejoining WPTC after a lengthy series of off-wiki discussions, contingent upon the WikiProject improving its conduct. A MoTM of this edition, CycloneFootball71 also decided to retire, following the decision of Destroyeraa to quit WPTC, but quickly reconsidered and instead took an indefinite WikiBreak, which later became a Semi-WikiBreak. LightandDark2000 himself also considered quitting from WPTC and leaving Wikipedia entirely (since WPTC activities are his primary reason for being on Wikipedia in the first place), but he decided to stay for now (unless things continue to grow worse, in which case, a full retirement as a registered user is likely). Another MoTM, CodingCyclone, went on a semi-WikiBreak instead of quitting like some of others did. Although the worst of the turmoil seems to be over now, WPTC is still slowly recovering from the damage. However, it is clear, unfortunately, that JavaHurricane will not return to the project, due to the loss of faith and time. We hope that this will never happen again. To JavaHurricane himself: thank you. Thanks for all the edits you've made in 2020 and in 2021. You are one of the building blocks that led to the WPTC revival last year. Without you, we would have had more difficulty combating some of the LTAs we've recently dealt with. You've made plenty of quality improvements and also carried out a decent amount of anti-vandalism activities. If you ever wish to rejoin the project, you will always be welcome here. We wish you luck in your future endeavors.
From March 1 to April 30, one featured list was promoted. From the Main Page: Documents WikiProject-related materials that have appeared on the main page from March 1–April 30, 2021 in chronological order. March 11 – Typhoon Maemi
There is an article currently nominated as featured list candidate: Article of the Month: Tropical Storm Rolf Tropical Storm Rolf, also known as Tropical Storm 01M, was an unusual Mediterranean tropical storm that brought flooding to Italy, France, Spain, and Switzerland in November 2011. Rolf originated from an extratropical system near western France on November 4. For the next few days, Rolf moved eastward into the Mediterranean Sea, before making a slow clockwise loop off the coast of France. Despite the generally unfavorable conditions in the Mediterranean Sea, Rolf transitioned into a subtropical depression on November 7, before becoming a tropical storm later that day and turning northeastward. On November 8, Rolf reached its peak intensity, with 1-minute sustained winds peaking at 85 km/h (50 mph, 45 kn) and a minimum central pressure of 991 mb (29.3 inHg). During the next day, the storm turned westward and made landfall on the island of Île du Levant, in France, and soon afterward, near Hyères in southeastern France. Following its second landfall, Rolf quickly weakened, dissipating on November 10. Rolf was the first tropical cyclone ever to be officially monitored by the NOAA in the Mediterranean Sea. Rolf caused widespread flooding across southwestern Europe, especially in France and Italy, with the majority of the damage from the storm occurring in those two countries. Torrential rainfall from Rolf caused multiple rivers to overflow their banks in France and Italy, flooding multiple cities and resulting in extensive property damage. The storm forced numerous schools and businesses to close temporarily, and also caused significant damage to 300 farms in France. Floodwaters from Rolf's rainfall also cut the power to over 8,000 customers and necessitated thousands of rescues, in addition to forcing thousands of evacuations. The storm also caused the largest flood event seen in Gipuzkoa, in northern Spain since 1983. Rolf killed 12 people, and the storm was also the costliest Mediterranean tropical-like cyclone in the 2010s, with the storm causing at least $1.25 billion (2011 USD, €925 million) in damages. Current assessment table Assessments valid as of this printing. Depending on when you may be viewing this newsletter, the table may be outdated. See here for the latest, most up to date statistics.
Project Goals & Progress The following is the current progress on the three milestone goals set by the WikiProject as of this publishing. They can be found, updated, at the main WikiProject page.
How to Cite Sources on Tropical Cyclone Articles, by LightandDark2000 In my years of experiences here on WPTC (and on Wikipedia, in general), I've noticed that citing sources properly is a skillset that many editors are lacking in. While a good number of the experienced editors are familiar with how to fill out citations on Wikipedia, this is something that the most of the newer editors struggle with, especially those who have never written a research paper before. Given the influx of new members in WPTC over the past year, I've decided to write a simple tutorial on how to properly complete citations in tropical cyclone articles. First of all, lets start with a standard citation template. This format will be used for the vast majority of citations on tropical cyclone articles: For our example, lets use this special "Tropical Cyclone Update" advisory for Hurricane Isaias, which was issued when the storm made landfall in North Carolina, early on August 4, 2020 (UTC time).
Once you have done all of this, your completed citation should have the following code: Which should appear as follows in the article:[1] With this tutorial, hopefully you now know how to properly cite sources within tropical cyclone articles. Properly citing sources is a crucial skill on Wikipedia. It allows you to make complete, professional references that can be accessed and reused by just about any other editor. Additionally, creating incomplete or improper citations forces other more experienced users to clean up after you, which not only wastes time, but also prevents an article from becoming a Good Article or Featured Article until these issues are completely resolved. Citing sources is an important skill and one that every experienced editor is expected to master. Citing sources takes time to learn, so don't be discouraged if you don't fully master the art at the beginning. As with everything else in life, new skills require "practice" to perfect, and as you cite more and more sources, you'll find that citing sources becomes easier and faster for you. I hope you find this guide useful in your journey on Wikipedia. May it help mold you into a superb writer, like many other experienced editors who have come before you. Best of luck, and happy editing! ~ LightandDark2000 🌀
Destroyeraa and the Project, by Chicdat, CodingCyclone, CycloneFootball71, MarioJump83, and LightandDark2000 Destroyeraa registered his account on Wikipedia in January 2020. He gained experience like all of us, and received several user rights in the process. He improved several articles to GA status, the first being Hurricane Dolores (2015). He made WikiProject Tropical cyclones a good place to be. He made some mistakes, of course, but learned from them quickly. But by 2021, real life seemed to be catching up to Destroyeraa. He went into periods of semi-wikibreaks. His editing became more sporadic. He has not edited since March 3, 2021. WikiProject Tropical cyclones has experienced plenty of turmoil since then, especially in late March and early April. Some users have been very hostile. There has been copyright problems. Drama is being created. With the exception of a few remarks by LightandDark2000 on-wiki, the project has not heard from him for a long time. I wish that he would come back, and I miss him. When Destroyeraa went, it seems that the short revival of WikiProject Tropical cyclones went with him as well. I came as the renewal of WPTC was beginning, so I knew no other state of the project. To Destroyeraa himself: Please come back. You made the WikiProject a good place to be. I miss you so much; you were like a real life friend. ~ 🐔 Chicdat Bawk to me! Destroyeraa was the person who invited me to the project. Like many others, his hard work and diligence made him a role model to me. Without him, I probably wouldn't be where I am today. He gave me advice when I was trying to improve Hurricane Fran (which I never completed, but would like to do as an honor to him) and helped me realize some of my earlier edits were a bit CIR-y and disruptive (albeit unintentionally). He was always unfailingly civil and helped other editors when they were down. He also created the Cyclone Cup which is actually really fun and something that I personally would never have thought of, and is helping to drive some people to create and improve more articles. To me, he was a symbol of the rebirth of WPTC. When he left, it seemed as though that age disappeared. I know that real life always takes precedence over Wikipedia, but hopefully he can figure out how to balance the two and come back soon. CodingCyclone! 🌀 📘 Destroyeraa has had a profound effect on the WPTC. He has been so helpful and kind throughout his time on Wikipedia, and I want to thank him for that. He has done so much for us throughout his time here, and Wikipedia has not been the same for the project since he left. He has helped me through lots, during some very difficult times, and he has been a great friend. He helped me create my first Opinion piece ever, which helped me get into editing these newsletters for the editors of this project. Despite some mistakes, he overcame these and became even better than before, and he really inspired me to improve myself in the realm of editing tropical cyclones. He did so much for this project, and me and the rest of this Wikiproject want to thank him for all that he has done. I am not sure what else to say, as Chicdat and CodingCyclone said everything that was in my mind. However, he was a great friend. Destroyeraa, you will be missed here on Wikipedia. I hope one day you may return and regain your faith in WPTC again, but for now, I only hope and wish for the absolute best for your life. Thank you again. 🌀CycloneFootball71🏈 |sandbox Destroyeraa brought me to speed during my initial WPTC tenure as SMB99thx, since I was not that active in my first years and also not aware of Wikipedia's changing guards, like newer users having advanced permissions so quickly, having many user scripts, very communicative on-and-off-wiki (i.e. using Discord), and so much more that I don't understand back when I first joined in WPTC. By learning from him, eventually, I did have the same advanced permissions like his up to last month, having many user-scripts, as well as using a custom theme for Wikipedia, which is not Vector, and its very cool! Without him, I may have been going into a path Chicdat is currently taking right now, as Chicdat wasn't able to stay as a page mover and a rollbacker early in his Wikipedia career, then got into several troubles which led me into adopting him. Now, I am going to give him lessons that I learned from Destroyeraa himself. Other than that, I don't have anything much to say about him, but I hope he's back again to help me once more, and bring me further growth as an editor going forward, which could potentially assist me at shepherding Chicdat into a better place. MarioJump83! The others above have pretty much captured what I would like to say, and since Destroyeraa and I have stayed in contact off-wiki, I'll make this brief. Destroyeraa was a one-of-a-kind. I've been here for 12 years now, and I have to say that I've rarely ever come across someone like him; even less so in real life. The work he has done in just one year on Wikipedia (as a registered user) is absolutely astounding; it took me 6 years for my editing to reach that level of professionalism. I have not seen anyone like him show up on WPTC since Hurricane Noah joined in 2017. He is really smart, and he is also one of the nicest people I've ever met. And he's a very good friend as well. Destroyeraa, I bet you were able to guess most of what I said here, but you should know that you're a real gem. Those of us here miss you, and there are others as well. And I did tell you that your absence would be felt, didn't I? Regardless of what you think, what you do here does and will affect us. I'm very happy that you've decided to come back this summer, once you get out of school. I hope to see you around the place then. Your friend, LightandDark2000 🌀 |
Status on Destroyeraa
Hey. I saw something happened with Destroyeraa (I want ping him as I don't want to reopen closed wounds) involving a sock puppet user getting banned. If I may ask, as I don't know much about it, what exactly happened? I hope everything is all good now by the way.ChessEric (talk · contribs) 20:48, 2 May 2021 (UTC)
- @ChessEric: The socking episode was in the past, all the way back in late November, which I think most of us were aware of. He hasn't had anything like that since. As for his inactivity, he's extremely busy due to school. He probably won't be back until after he gets out of school in late June, around June 24-ish. Since then, he has had a string of health issues (up to mid-March) and he did have a surgical operation on his right arm in early April, but I think that he's okay right now. And I've kept in close contact with him off-wiki, so we pretty much know about the things that are happening in each other's lives. And that's how I knew so much about his activities and what he has been thinking. I think he should be back in late June, though. LightandDark2000 🌀 (talk) 00:13, 3 May 2021 (UTC)
- Ok. Gotcha. However, I was talking about the recent sock puppetry episode with the guy who supposedly wanted to join the WPTC project.ChessEric (talk · contribs) 00:32, 3 May 2021 (UTC)
- Oh. That one. Well, I think he got over it soon afterward. Especially when it turned out that the kid was an LTA. He does take things pretty hard on himself at times. LightandDark2000 🌀 (talk) 01:02, 3 May 2021 (UTC)
- Ok. Gotcha. However, I was talking about the recent sock puppetry episode with the guy who supposedly wanted to join the WPTC project.ChessEric (talk · contribs) 00:32, 3 May 2021 (UTC)
A brownie for you!
Hello, LightandDark2000. I hope you enjoy this brownie (I saw on your userpage that you enjoyed ice cream, but, alas, WikiLove doesn't include ice cream in its selection of treats). I just wanted to personally thank you for thanking me so many times. I count seven instances just this year alone, and it is always a good feeling to check my notifications and see a small token of appreciation. That's all. Keep up the good work, friend, and stay safe! God bless. Thanks, EDG 543 (message me) 17:20, 5 May 2021 (UTC) |
- No problem! :) LightandDark2000 🌀 (talk) 21:39, 13 May 2021 (UTC)
Bluecar125
The user Bluecar125 is still vandalizing Betty Haas Pfister and Murder of Nancy Pfister. Can you revert there edits ? 172.58.110.139 (talk) 19:20, 12 May 2021 (UTC)
- Done. Honestly, I'm surprised that no one took out that vandal earlier. LightandDark2000 🌀 (talk) 20:03, 12 May 2021 (UTC)
A barnstar for you!
The Editor's Barnstar | |
Congrats on getting Autopatrolled rights! ~~ 🌀𝚂𝙲𝚂 𝙲𝙾𝚁𝙾𝙽𝙰🌀 13:41, 13 May 2021 (UTC) |
- Thanks! LightandDark2000 🌀 (talk) 21:39, 13 May 2021 (UTC)
Pings at AIV
Hi LightandDark2000, thank you very much for the numerous reports, but please don't ping administrators in any report that isn't about recent, ongoing, active vandalism requiring emergency intervention. The latest ping was about an account that didn't edit for over a week. ~ ToBeFree (talk) 19:44, 14 May 2021 (UTC)
- I just thought that you would be interested since you had blocked the same person on their other account. Regardless, I have been more reserved in my usage of pings at AIV. LightandDark2000 🌀 (talk) 19:49, 14 May 2021 (UTC)
Notice about a new WikiProject Proposal
This is a friendly notice about a proposal to have yearly based WikiProjects. You can find the proposal by clicking here. Elijahandskip (talk) 19:05, 16 May 2021 (UTC)
- My Apologies LightandDark2000. I "jumped the gun" in the fact that I forgot to actually make the proposal official. I have done that now, so feel free to leave your opinion on the actually proposal. (See: Wikipedia:WikiProject Council/Proposals/2021). Elijahandskip (talk) 19:05, 18 May 2021 (UTC)
Borderline comments
Just a note, it is generally not a good idea to refer to the ages of editors, especially when they're on the lower end of the numerical age scale. I have not needed to remove any of your comments, but I thought I'd mention it. Feel free to email me if you want specifics of the issue that brought me here. Primefac (talk) 23:17, 16 May 2021 (UTC)
A barnstar for you!
The Barnstar of Diligence | ||
Two reasons: 1) After taking a look back at the whole Amanda/Cristobal merger, I felt that you handled a lot of angry editors pretty well and made a good but civil argument. 2) Diligence specifically becuase of how active you've remained in editing during the off-season and how well done those edits were. Thanks for being such a great Wikipedian! JayTee🐦 13:04, 17 May 2021 (UTC) |
- Thanks! I'm just doing my part to help mediate in some of these disputes, when necessary. And I've been doing my best to keep a level head on on-wiki, even though it has grown difficult to do so at times. LightandDark2000 🌀 (talk) 16:14, 17 May 2021 (UTC)
Cyclone Inigo Good Article Reassessment
Cyclone Inigo, an article that you or your project may be interested in, has been nominated for an individual good article reassessment. If you are interested in the discussion, please participate by adding your comments to the reassessment page. If concerns are not addressed during the review period, the good article status may be removed from the article. --Whiteguru (talk) 11:26, 22 May 2021 (UTC)
Please communicate with new editors
Please say something to new editors when you revert their changes, as you did here. That's not a clear case of vandalism. Between the silence on their talk page and the generic edit summary, there's no way for them to know anything about what's going on. They've no sign that they're at all welcome here, or that their work might have some value and that they should stay. This new editor was at least paying attention to what they're doing and leaving edit summaries, which is more than can be said for many. Once they learn the rules, they may be productive and helpful. We want to encourage that. Thanks, BlackcurrantTea (talk) 08:31, 26 May 2021 (UTC)
- @BlackcurrantTea: This is why that I'm refusing to engage in further anti-vandalism activities. To take care of them I'm relying on SRG to get the job done. MarioJump83! 10:35, 26 May 2021 (UTC)
- This isn't a requirement at all, IMO. Also, their edit was definitely disruptive. And I certainly do not have to leave a message after every single revert (especially in cases of likely drive-by vandals. If someone wants to welcome people whose edits are primarily disruptive, they can be my guest. I normally don't do that kind of stuff. LightandDark2000 🌀 (talk) 12:58, 26 May 2021 (UTC)
A barnstar for you!
The Special Barnstar | |
Hello LightandDark2000. I just want to thank you for everything that you have done here on WP, I really appreciate your kindness, your hard-work, and your willingness to help other editors. I want to thank you for convincing Destroyeraa to come back as well. I want to also thank you for being such a role-model to the community, and for stepping up and being a leader especially when things got tough for the WPTC (like this) and for always supporting me when I came close to leaving or quitting WP, and your constant support. I want to thank you for being a great editor, and a great friend, it means a lot. Keep up the great work, it is really appreciated. 🌀CycloneFootball71🏈 |sandbox 05:35, 29 May 2021 (UTC) |