User:Conorrickard/Cyanovirin-N
The protein Cyanovirin-N (CV-N) and its bacterial origination N. ellipsosporum were screened for and discovered as being antiviral in the lab of Michael R. Boyd MD, PhD, University of South Alabama, 1997[1]. It originally gained notable interest in its ostensible use as an antiviral topical agent to be applied before intercourse. It is antiviral against HIV-1, HIV-2, SIV, HCV, HSV-1, Influenza A and B, Ebola, and MARV[2].
Bacterial origin
[edit]Cyanobacteria, primary colonizers found mostly in ocean water, have evolved with many protective traits including antiviral activity[3]. CV-N is a lectin protein produced by Nostoc ellipsosporum, a fresh water, gram negative, unbranched filamentous cyanobacteria.
Structure
[edit]The CV-N protein is made from 101 amino acids forming a monomer with two nearly identical domains hinged near the 50th amino acid. Torsion angle can separate the two domains, domains A and B. It is most often found in crystalized form to have been separated then reassociated with neighboring domains from the other separated monomers, repeatedly forming AB’ or BA’ pseudo-monomers also called domain-swapped dimers[4]. CV-N is a mostly beta-sheet protein and its mass is 11 kilodaltons.
Its amino acid sequence is: LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE
Mechanism against viruses
[edit]The CV-N lectin protein interacts with carbohydrates found on the surfaces of viruses. This halts their activity and ability to bind to target cell membranes.
The HIV envelope glycoprotein, gp120 contains high-mannose sugars[5]. gp120 interacts with CD4 of the human T-cell and with gp140 fuses the viral and human menmbrane[6]. Similarly, the SARS-CoV-2 envelope produces a spike protein with an S glycoprotein containing high-mannose sugars carrying out membrane fusion[7].
CV-N recognizes the N-linked high mannose sugars and interacts with Man-8 and Man-9 sugars[8]. It is not known if both Man-8 and Man-9 are required or redundant.
Related
[edit]“While CVN was originally thought to be an orphan lectin with little homology to any other known protein family, a family of CVN homologs, termed CVNHs, has been described“[9].
 | This is the sandbox page where you will draft your initial Wikipedia contribution.
If you're starting a new article, you can develop it here until it's ready to go live. If you're working on improvements to an existing article, copy only one section at a time of the article to this sandbox to work on, and be sure to use an edit summary linking to the article you copied from. Do not copy over the entire article. You can find additional instructions here. Remember to save your work regularly using the "Publish page" button. (It just means 'save'; it will still be in the sandbox.) You can add bold formatting to your additions to differentiate them from existing content. |
References
[edit]- ^ Boyd, M. R.; Gustafson, K. R.; McMahon, J. B.; Shoemaker, R. H.; O'Keefe, B. R.; Mori, T.; Gulakowski, R. J.; Wu, L.; Rivera, M. I.; Laurencot, C. M.; Currens, M. J.; Cardellina, J. H.; Buckheit, R. W.; Nara, P. L.; Pannell, L. K. (1997-07). "Discovery of cyanovirin-N, a novel human immunodeficiency virus-inactivating protein that binds viral surface envelope glycoprotein gp120: potential applications to microbicide development". Antimicrobial Agents and Chemotherapy. 41 (7): 1521–1530. doi:10.1128/AAC.41.7.1521. ISSN 0066-4804. PMID 9210678.
{{cite journal}}: Check date values in:|date=(help) - ^ Mitchell, Carter A.; Ramessar, Koreen; O'Keefe, Barry R. (2017-06). "Antiviral lectins: Selective inhibitors of viral entry". Antiviral Research. 142: 37–54. doi:10.1016/j.antiviral.2017.03.007. ISSN 0166-3542.
{{cite journal}}: Check date values in:|date=(help) - ^ "Shibboleth Authentication Request". login.csumb.idm.oclc.org. doi:10.1002/cdt3.11. PMC 9086949. PMID 35572950. Retrieved 2023-04-26.
{{cite web}}: CS1 maint: PMC format (link) - ^ Botos, Istvan; O’Keefe, Barry R.; Shenoy, Shilpa R.; Cartner, Laura K.; Ratner, Daniel M.; Seeberger, Peter H.; Boyd, Michael R.; Wlodawer, Alexander (2002-09). "Structures of the Complexes of a Potent Anti-HIV Protein Cyanovirin-N and High Mannose Oligosaccharides". Journal of Biological Chemistry. 277 (37): 34336–34342. doi:10.1074/jbc.m205909200. ISSN 0021-9258.
{{cite journal}}: Check date values in:|date=(help)CS1 maint: unflagged free DOI (link) - ^ Matei, Elena; Basu, Rohan; Furey, William; Shi, Jiong; Calnan, Conor; Aiken, Christopher; Gronenborn, Angela M. (2016-09). "Structure and Glycan Binding of a New Cyanovirin-N Homolog". Journal of Biological Chemistry. 291 (36): 18967–18976. doi:10.1074/jbc.m116.740415. ISSN 0021-9258.
{{cite journal}}: Check date values in:|date=(help)CS1 maint: unflagged free DOI (link) - ^ "Envelope glycoprotein GP120", Wikipedia, 2023-03-02, retrieved 2023-04-26
- ^ Duan, Liangwei; Zheng, Qianqian; Zhang, Hongxia; Niu, Yuna; Lou, Yunwei; Wang, Hui (2020-10-07). "The SARS-CoV-2 Spike Glycoprotein Biosynthesis, Structure, Function, and Antigenicity: Implications for the Design of Spike-Based Vaccine Immunogens". Frontiers in Immunology. 11. doi:10.3389/fimmu.2020.576622. ISSN 1664-3224.
{{cite journal}}: CS1 maint: unflagged free DOI (link) - ^ Barrientos, Laura G.; Matei, Elena; Lasala, Fátima; Delgado, Rafael; Gronenborn, Angela M. (2006-09-29). "Dissecting carbohydrate–Cyanovirin-N binding by structure-guided mutagenesis: functional implications for viral entry inhibition". Protein Engineering, Design and Selection. 19 (12): 525–535. doi:10.1093/protein/gzl040. ISSN 1741-0134.
- ^ "Cyanovirin-N (CVN) - CFGparadigms". www.functionalglycomics.org. Retrieved 2023-04-26.