Talk:Ta3a

	This article was reviewed by member(s) of WikiProject Articles for creation. The project works to allow users to contribute quality articles and media files to the encyclopedia and track their progress as they are developed. To participate, please visit the project page for more information.Articles for creationWikipedia:WikiProject Articles for creationTemplate:WikiProject Articles for creationAfC articles
	This article was accepted from this draft on 24 October 2024 by reviewer Graeme Bartlett (talk · contribs).

	This article is within the scope of WikiProject Chemicals, a daughter project of WikiProject Chemistry, which aims to improve Wikipedia's coverage of chemicals. To participate, help improve this article or visit the project page for details on the project.ChemicalsWikipedia:WikiProject ChemicalsTemplate:WikiProject Chemicalschemicals articles
???	This article has not yet received a rating on the project's importance scale.

	Insects portal This article is within the scope of WikiProject Insects, a collaborative effort to improve the coverage of insects on Wikipedia. If you would like to participate, please visit the project page, where you can join the discussion and see a list of open tasks.InsectsWikipedia:WikiProject InsectsTemplate:WikiProject InsectsInsects articles
???	This article has not yet received a rating on the project's importance scale.

Sequence

Sequence given here is:

LAPIFALLLLSGLFSLPALQHYIEKNYIN

But translation appears to have extra on two ends https://www.uniprot.org/uniprotkb/P0DX61/entry

MKAPKFLFIAVIIVGLSGSLTWASPLPKAKAVADAMAAAEALAEAEPEALAPIFALLLLSGLFSLPALQHYIEKNYINGK

with length 80. I am assuming the article specified one is right.