Wikipedia:Historical archive/Logs/Deletion log/June 2004 (1)
Appearance
(Redirected from Wikipedia:Deletion log/June 2004 (1))
- 05:31, 11 Jun 2004 Maximus Rex deleted "Roger's Rangers" (content was: '#REDIRECT [[Rogers' Rangers]]' no such page)
- 05:25, 11 Jun 2004 Maximus Rex deleted "John Nebthos Project" (more John Nebthos nonsense)
- 05:24, Jun 11, 2004 RickK deleted "Vladimir Yefimovich Semichastny" (content was: 'The KGB was happy to have him.')
- 05:24, Jun 11, 2004 RickK deleted "Aceh Tamiang" (content was: 'pase aceh timur')
- 05:18, 11 Jun 2004 Guanaco deleted "User:Guanaco/Sandbox"
- 05:15, 11 Jun 2004 Guanaco deleted "User:Guanaco/Sandbox"
- 05:12, 11 Jun 2004 Guanaco deleted "User:Guanaco/Sandbox" (content was: '{(test)}{(test2)}{(test3)}{(test4)}{(test5)}----{(spam)}{(spam2)}{(spam3)}{(spam4)}----{(revert)}{(revert2)}{(revert3)}{(rev...')
- 04:47, 11 Jun 2004 Guanaco deleted "Redeemers" (content was: '== Headline text ==i<math><math><math>------{(User:Brockert/sig)} 23:09, Jan 8, 2005 (UTC)''''''''''' realy love michael arballo so much he is the hottest guy at our school Kassie realy l...')
- 04:46, 11 Jun 2004 Guanaco restored "Wikipedia:Tutorial_(Editing)/sandbox"
- 04:46, 11 Jun 2004 Guanaco deleted "Wikipedia:Tutorial (Editing)/sandbox" (content was: 'Yo. :o) I think I like this!This is a note I'm typing to edit this page.Yeah, well, suits you.')
- 04:23, 11 Jun 2004 UtherSRG deleted "Category:Life" (content was: '{(delete)}')
- 04:23, 11 Jun 2004 UtherSRG deleted "The Wealth of Nations: Book One, Chapter III" (content was: '{(delete)}Division of Labor is limited by the extent of the market.')
- 04:20, 11 Jun 2004 UtherSRG deleted "WIkiWoredsWork" (content was: '{(delete)}This is a new page')
- 04:19, 11 Jun 2004 UtherSRG deleted "Category:Abstraction" (content before blanking was: '{(delete)}[[Abstraction]][[:Category:Fundamental]][[:Category:Mind]]')
- 04:13, 11 Jun 2004 Guanaco deleted "Image:Uz-map.jpg" (IFD since May 24)
- 04:13, 11 Jun 2004 Guanaco deleted "Image:Tw-map.jpg" (IFD since May 24)
- 04:13, 11 Jun 2004 Guanaco deleted "Image:Sr-map.jpg" (IFD since May 24)
- 04:13, 11 Jun 2004 Guanaco deleted "Image:Pg-map.jpg" (IFD since May 24)
- 04:13, 11 Jun 2004 Guanaco deleted "Image:Mx-map.jpg"
- 04:13, 11 Jun 2004 Guanaco deleted "Image:Japan-map.jpg" (IFD since May 24)
- 04:13, 11 Jun 2004 Guanaco deleted "Image:Ic-map.jpg" (IFD since May 24)
- 04:13, 11 Jun 2004 Guanaco deleted "Image:Gg-map.JPG" (IFD since May 24)
- 04:12, 11 Jun 2004 Guanaco deleted "Image:Eg-map.jpg" (IFD since May 24)
- 04:12, 11 Jun 2004 Guanaco deleted "Image:Ek-map.jpg" (IFD since May 24)
- 04:12, 11 Jun 2004 Guanaco deleted "Image:En-map.jpg" (IFD since May 24)
- 04:12, 11 Jun 2004 Guanaco deleted "Image:Da-map.jpg" (IFD since May 24)
- 04:12, 11 Jun 2004 Guanaco deleted "Image:Cs-map.jpg" (IFD since May 24)
- 04:12, 11 Jun 2004 Guanaco deleted "Image:Br-map.jpg" (IFD since May 24)
- 04:01, 11 Jun 2004 Guanaco deleted "Image:Espirito Santo Map With Serra Municipality Highlighted.bmp" (IFD since May 24)
- 04:01, 11 Jun 2004 Guanaco deleted "Image:Espirito Santo Map with Afonso Claudio Municipality Highlighted.bmp" (IFD since May 24)
- 04:01, 11 Jun 2004 Guanaco deleted "Image:Espirito Santo Map with Domingos Martins Municipality Highlighted.bmp" (IFD since May 24)
- 04:01, 11 Jun 2004 Guanaco deleted "Image:Espirito Santo Map with Linhares Municipality Highlighted.bmp" (IFD since May 24)
- 04:01, 11 Jun 2004 Guanaco deleted "Image:Espirito Santo Map with Marechal Floriano Municipality Highlighted.bmp" (IFD since May 23)
- 04:01, 11 Jun 2004 Guanaco deleted "Image:Espirito Santo Map with Venda Nova do Imigrante Municipality Highlighted.bmp" (IFD since May 23)
- 04:01, 11 Jun 2004 Guanaco deleted "Image:Espirito Santo Map with Vila Velha Municipality Highlighted.bmp" (IFD since May 23)
- 03:59, 11 Jun 2004 Guanaco deleted "Image:Fi-map.jpg" (IFD since May 23)
- 03:59, 11 Jun 2004 Guanaco deleted "Image:Sz-map.jpg" (IFD since May 23)
- 03:59, 11 Jun 2004 Guanaco deleted "Image:Lo-map.jpg" (IFD since May 23)
- 03:59, 11 Jun 2004 Guanaco deleted "Image:Gr-map.jpg" (IFD since May 23)
- 03:59, 11 Jun 2004 Guanaco deleted "Image:Gm-map.jpg Germany.jpg" (IFD since May 23)
- 03:59, 11 Jun 2004 Guanaco deleted "Image:De-map.jpg" (IFD since May 23)
- 03:59, 11 Jun 2004 Guanaco deleted "Image:Ci-map.jpg" (IFD since May 23)
- 03:59, 11 Jun 2004 Guanaco deleted "Image:Bo-map.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:Bm-map.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:Bk-map.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:Biot-map.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:Au-map.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:Vikinglander1-1-thumb.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:OnobrychisViciifolia-thumb.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:Moon-craters-thumb.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:Moon-surface-thumb.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:GymnadeniaConopsea-thumb.jpg" (IFD since May 23)
- 03:58, 11 Jun 2004 Guanaco deleted "Image:BluebellWood-thumb.jpg" (IFD since May 23)
- 03:56, 11 Jun 2004 Guanaco deleted "Image:IgnacyJanPaderewsky.jpg" (requested by uploader - typo in filename)
- 03:56, 11 Jun 2004 Guanaco deleted "Image:IgnacyJanPaderewsly.jpg" (requested by uploader - typo in filename)
- 03:54, 11 Jun 2004 Guanaco deleted "The Wealth of Nations: Book One, Chapter III" (content was: 'Division of Labor is limited by the extent of the market.')
- 03:41, 11 Jun 2004 Guanaco deleted "3D computer graphics.html" (content was: '3D GRAPHICS ARE ON COMPUTERS, They are used in many faucets oflife in this day and age.{(msg:delete)}')
- 03:30, Jun 11, 2004 SimonP deleted "Nipple piercing" (content was: '''See also:'' [[Body piercing]]{(msg:stub)})
- 03:26, Jun 11, 2004 SimonP deleted "Reykholt (Borgarfjörður)" (content was: '{(cleanup)}[http://www.islandsmyndir.is/html_skjol/vesturland/reykholt/forsida_reykholt1.htm Reykholt - picture gallery from islandsmyndir.is]')
- 03:12, 11 Jun 2004 Infrogmation deleted "P. Du Val" (content was: '===Works===* ''The Fifty-Nine Icosahedra'' (with [[H. S. M. Coxeter]], [[H. T. Flather]], [[J. F. Petrie]])[[Category:Mathematicians]]{(stub)}')
- 03:12, 11 Jun 2004 Infrogmation deleted "J. F. Petrie" (there is no article here. content was: '===Works===* ''The Fifty-Nine Icosahedra'' (with [[H. S. M. Coxeter]], [[P. Du Val]], [[H. T. Flather]])[[Category:Mathematicians]]{(stub)}')
- 03:10, 11 Jun 2004 Infrogmation deleted "Brian McFayden" (content was: 'A former MTV VJ and is currently the host of the WB's superstar show.')
- 02:15, 11 Jun 2004 Angela deleted "Image:Cia wfb flag - isle of man.png" (uploaded with wrong name. Speedy deletion requested by uploader)
- 02:15, 11 Jun 2004 Angela deleted "Image:Im-lgflag.png" (uploaded with wrong name. Speedy deletion requested by uploader)
- 02:02, 11 Jun 2004 Snoyes deleted "Ben Jimenez" (content was: 'Ben is a fag')
- 01:51, 11 Jun 2004 Camembert restored "Wikipedia:Sandbox"
- 01:48, 11 Jun 2004 Guanaco deleted "Wikipedia:Sandbox" (clearing sand)
- 01:48, 11 Jun 2004 Cyrius deleted "Template:Deletion" (something weird's going on)
- 01:30, 11 Jun 2004 Meelar deleted "Zvitko Barkanovic" (on vfd five days, material appears false)
- 01:11, 11 Jun 2004 Snoyes deleted "Talk:Earned run" (content was: 'gfdsgfdsgfsdgfsd')
- 01:04, 11 Jun 2004 Bryan Derksen deleted "Template:Doesn't inherit subcategories" (content was: '''This category's subcategories are related to this topic, but the articles they contain are not necessarily valid members of this category directly.'...' - Just created this myself with an incorrect name, sorry. No history, no links.)
- 01:03, 11 Jun 2004 Bryan Derksen deleted "Template:Inherits subcategories" (content was: '''The subcategories of this category contain articles which are also valid members of this category but which have been divided up into more specific ...' - just created this myself with an incorrect name, sorry. No history.)
- 00:56, 11 Jun 2004 Isomorphic deleted "Main Page/fag" (content was: '{(delete)}')
- 00:53, 11 Jun 2004 Snoyes deleted "Main Page/fag" (content was: 'asdfasdfasdfasfasdfasdf')
- 00:15, 11 Jun 2004 UtherSRG deleted "Category:Mother goddesses" (content was: 'See instead [[:Category:Fertility goddesses]] or [[:Category:Creator goddesses]].')
- 23:53, Jun 10, 2004 RickK deleted "Persecution and the Art of Writing" (content was: '{(delete)}' I already deleted it once)
- 23:48, 10 Jun 2004 Francs2000 deleted "Music of Libya" (content was: 'fj fgdgh')
- 23:37, Jun 10, 2004 RickK deleted "Amy Henry" (content before blanking was: 'yo spagettio')
- 23:29, Jun 10, 2004 RickK deleted "Tengiz Abuladze" (content was: '[[de:Tengis Abuladse]]')
- 23:23, Jun 10, 2004 RickK deleted "Otar Ioseliani" (content was: '[[de: Otar Iosseliani]]')
- 22:54, 10 Jun 2004 Texture deleted "Lupe" (content was: 'a lupe is a neopet if you like neopets go to www.neopets.com also a jub jub,a aisha ,a grundo,a chomby, a croc, a sorchio, a uni and a yurbal are neo...')
- 22:50, 10 Jun 2004 UtherSRG deleted "Condesa del Mar"
- 22:49, 10 Jun 2004 UtherSRG deleted "Category:Deities of wisdom" (content was: '{(delete)}')
- 22:49, 10 Jun 2004 UtherSRG deleted "Category:Goddesses of wisdom" (content was: '{(delete)}')
- 22:49, 10 Jun 2004 UtherSRG deleted "Category:Gods of wisdom" (content was: '{(delete)}')
- 22:46, 10 Jun 2004 UtherSRG deleted "Category:Fantasy authors" (content was: '[[Category:Writers]]')
- 22:42, 10 Jun 2004 Mirv deleted "Lugus" (nonsense - content was: '{(delete)}A small round object, such as a lugwig, or perriwinkle.')
- 22:17, 10 Jun 2004 Mic deleted "Category:Norwegian Vice Roys" (Replaced by Category:Norwegian Viceroys)
- 22:07, 10 Jun 2004 Mirv deleted "Steamies vs. Diesels & Other Thomas Adventures" (content was: '{(msg:delete)}this is a stupid movie!!!!!!')
- 22:06, 10 Jun 2004 Mirv deleted "Hacker clans" (content was: '------[[User:195.23.181.102|195.23.181.102]] 22:02, 10 Jun 2004 (UTC)<nowiki>Insert non-formatted text here</nowiki><math>Insert formula here</math>...')
- 21:58, 10 Jun 2004 Maximus Rex deleted "Twist and Shout" (content was: '{(msg:delete)}Mediocre song by the Beatles, with Paul McCartney on lead.')
- 21:58, 10 Jun 2004 Texture deleted "Adaption" (content was: 'The result or act of adaping (changing) something into another form.')
- 21:55, 10 Jun 2004 Texture deleted "H. T. Flather" (content was: '===Works===* ''The Fifty-Nine Icosahedra'' (with [[H. S. M. Coxeter]], [[P. Du Val]], [[J. F. Petrie]])===External link===[[Category:Mathematici...')
- 21:37, 10 Jun 2004 Texture deleted "Skullet" (content was: 'Al the driving instructor had a mean skullet. It was sick.')
- 21:31, 10 Jun 2004 Cyrius deleted "Talk:Head to toe position" (copyvio content intentionally copied from article page)
- 21:17, 10 Jun 2004 Gentgeen deleted "Category:Elements" (deleting, unused, duplicates [[Category:Chemical elements]])
- 21:10, 10 Jun 2004 Jiang deleted "Dragan Jocic/Temp" (copied to [[Dragan Jocic]] by sole contributor)
- 21:08, 10 Jun 2004 Jiang deleted "Constitution of Medina/Temp" (content was: '#REDIRECT [[Constitution of Medina]]')
- 21:06, 10 Jun 2004 Morwen deleted "South central asia" (content was: 'south central asia-o yea. i had a dog named south central asia once. he was a good boy. i have to go pee pee now. bye bye')
- 20:18, 10 Jun 2004 Meelar deleted "Budda Quest" (content was: '{(delete)}*Advert for a [[MMORPG]] that consists of a link to a web forum with only a few posts. -- [[User:DrBob|DrBob]] 20:14, 10 Jun 2004 (UTC)')
- 20:03, 10 Jun 2004 DavidWBrooks deleted "What happens to people who are delerious?" (content was: 'What Happens to people who are delerious?')
- 20:02, 10 Jun 2004 DavidWBrooks deleted "Hannapes" (content was: 'dufaye raymonde')
- 19:45, 10 Jun 2004 Texture deleted "1960 in art" (content was: '== Headline text ==Hello whooooo bye')
- 19:38, 10 Jun 2004 Deb deleted "Henri miller" (Duplicate article - it's about Henry Miller, only in German)
- 19:34, 10 Jun 2004 Texture deleted "Riki Rachtman" (content was: '{(delete)}Shittiest Loveline host ever!')
- 19:28, Jun 10, 2004 Jmabel deleted "The Causlities" (deleting redirect of a misspelling that was presumably the author's typo.)
- 19:13, 10 Jun 2004 Francs2000 deleted "Edgar Pierre Jacobs" (content was: '[[nl:Edgar P. Jacobs]][[de:E.P. Jacobs]][[fr:Edgar P. Jacobs]]{(msg: stub)}')
- 19:11, 10 Jun 2004 Francs2000 deleted "Jacques Martin (cartoonist)" (content was: '[[fr: Jacques Martin (auteur)]]{(msg:stub)}')
- 19:08, 10 Jun 2004 Francs2000 deleted "Användare:Habj" (content was: 'Habj will probably mainly be writing om martial arts, but irregularly.')
- 19:06, 10 Jun 2004 Francs2000 deleted "Balcom Agency" (content was: 'An advertising agency in Fort Worth, Texas.')
- 18:54, 10 Jun 2004 Texture deleted "Morrissey Breen" (nonsense - usenet poster born in 1853)
- 18:52, 10 Jun 2004 Guanaco deleted "Panfilovec" (content was: '{(msg:delete)}A desperate defense measure.')
- 18:51, 10 Jun 2004 Guanaco deleted "Image:Bernard lewis.jpg" (broken 0 byte image)
- 18:40, Jun 10, 2004 Dori deleted "Talk:Over-consumption" (content was: 'hhhhhhhhhhhhhhh')
- 18:39, Jun 10, 2004 Dori deleted "Operation Trinity" (content was: 'fuck you jeff chinn, ur a cock muncher who loves the dick deep in the ass')
- 18:38, 10 Jun 2004 DavidWBrooks deleted "Neubeuern" (content was: '{(msg:delete)}www.neubeuern.de')
- 18:38, 10 Jun 2004 DavidWBrooks deleted "Operation Trinity" (content was: 'Alex has a small dick and he puts it in his momjeff has a giant DICK!also...alex santellina likes sluts, whores, and MEN...YUMMY')
- 18:37, Jun 10, 2004 Dori deleted "Operation Trinity" (content was: 'Alex has a small dick and he puts it in his mom')
- 18:37, Jun 10, 2004 TUF-KAT deleted "Old Coke Drinkers of America" (content was: 'helppage')
- 18:29, 10 Jun 2004 Hemanshu deleted "Operation Trinity" (content was: ' JEFF IS THE STUPIDEST PERSON IN THE WORLD')
- 18:29, 10 Jun 2004 DavidWBrooks deleted "Elias sommer" (content before blanking was: 'Elias Sommer wurde am 27.09.1991 in Hamburg georen. Schon von Geburt an war er so derbe dumm, dass ihn alle hassten. Im Alter von 9 Jahren konnte er i...')
- 18:29, 10 Jun 2004 DavidWBrooks deleted "Childebert" (content was: 'Childebert')
- 18:08, Jun 10, 2004 Raul654 deleted "Walter Brittain" (content was: '#REDIRECT [[Walter Houser Brattain]]')
- 17:33, 10 Jun 2004 Texture deleted "Southern Thai language" (content was: 'hello , what you up to?')
- 17:27, 10 Jun 2004 Jdforrester deleted "Talk:Who invented hte Word Wide Web" (Speedy-delete; unattached talk page of no real content)
- 17:27, 10 Jun 2004 Texture deleted "Hawaiian religion" (content was: '#REDIRECT [[Polynesian mythology]]')
- 17:25, 10 Jun 2004 Mirv deleted "Lapinlahti" (content was: '{(msg:delete)}I am Paul Halonen, I believe I am a decendant of Pekka Halonen, My Father was born in Petsimo Finland where my Grand Mother and Grand ...')
- 17:21, 10 Jun 2004 UtherSRG deleted "Category:Ardeidae" (content was: '[[Category:Ciconiiformes]]')
- 17:21, 10 Jun 2004 UtherSRG deleted "Category:Marsupial" (content was: 'Articles related to ''[[Marsupials]]''[[Category:Mammalia]]')
- 17:16, 10 Jun 2004 Texture deleted "Talcahuano" (content was: '{(msg:delete)}City in Chile')
- 17:11, 10 Jun 2004 UtherSRG deleted "Category:Passeriformes" (content was: '[[Category:Aves]]')
- 17:11, 10 Jun 2004 UtherSRG deleted "Category:Cristata" (content was: '[[Category:Cyanocitta]]')
- 17:10, 10 Jun 2004 UtherSRG deleted "Category:Ciconiiformes" (content was: '[[Category:Aves]]')
- 17:10, 10 Jun 2004 UtherSRG deleted "Category:Corvidae" (content was: '[[Category:Passeriformes]]')
- 17:09, 10 Jun 2004 UtherSRG deleted "Category:Animalia" (content was: '[[Category:Eukaryota]]')
- 17:09, 10 Jun 2004 UtherSRG deleted "Category:Aves" (content was: '[[Category:Vertebrata]]')
- 17:08, 10 Jun 2004 UtherSRG deleted "Category:Orthonectida" (content was: '[[Category:Agnotozoa]]')
- 17:08, 10 Jun 2004 UtherSRG deleted "Category:Agnotozoa" (content was: '[[Category:Animalia]]')
- 17:08, 10 Jun 2004 UtherSRG deleted "Category:Porifera" (content was: '[[Category:Parazoa]]')
- 17:07, 10 Jun 2004 UtherSRG deleted "Category:Parazoa" (content was: '[[Category:Animalia]]')
- 17:06, 10 Jun 2004 Deb deleted "HENRY VIII" (duplicate article)
- 17:06, 10 Jun 2004 Ilyanep deleted "Category:Test" (this was me testing the categories feature)
- 17:06, 10 Jun 2004 UtherSRG deleted "Category:Bilateria" (content was: '[[Category:Metazoa]]')
- 17:06, 10 Jun 2004 UtherSRG deleted "Category:Protostomia" (content was: '[[Category:Bilateria]]')
- 17:05, 10 Jun 2004 UtherSRG deleted "Category:Mollusca" (content was: '[[Category:Protostomia]]')
- 17:05, 10 Jun 2004 UtherSRG deleted "Category:Neocoleoidea" (content was: '[[Category:Coleoidea]]')
- 17:05, 10 Jun 2004 UtherSRG deleted "Category:Octopodiformes" (content was: '[[Category:Neocoleoidea]]')
- 17:05, 10 Jun 2004 UtherSRG deleted "Category:Octopoda" (content was: '[[Category:Octopodiformes]]')
- 17:05, 10 Jun 2004 UtherSRG deleted "Category:Coleoidea" (content was: '[[Category:Cephalopoda]]')
- 17:04, 10 Jun 2004 UtherSRG deleted "Category:Cephalopoda" (content was: '[[Category:Mollusca]]')
- 17:04, 10 Jun 2004 UtherSRG deleted "Category:Aplacophora" (content was: '[[Category:Mollusca]]')
- 17:04, 10 Jun 2004 UtherSRG deleted "Category:Ameridelphia" (content was: 'Articles related to ''[[Ameridelphia]]''.[[Category:Marsupialia]]')
- 17:03, 10 Jun 2004 UtherSRG deleted "Category:Chordata" (content was: '[[Category:Deuterostomia]]')
- 17:03, 10 Jun 2004 UtherSRG deleted "Category:Marsupialia" (content was: '[[Category:Mammalia]]')
- 16:59, 10 Jun 2004 UtherSRG deleted "Category:Deuterostomia" (content was: '[[Category:Bilateria]]')
- 16:58, 10 Jun 2004 UtherSRG deleted "Category:Vertebrata" (content was: '[[Category:Chordata]]')
- 16:58, 10 Jun 2004 UtherSRG deleted "Category:Mammalia" (content was: 'Articles related to [[Mammals]][[Category:Vertebrata]]')
- 16:55, 10 Jun 2004 Hadal deleted "Lisa Taylor" (content was: '{(msg:delete)}A country music singer.')
- 16:53, 10 Jun 2004 UtherSRG deleted "Category:Carnivora" (content was: '[[Category:Placentalia]]')
- 16:52, 10 Jun 2004 UtherSRG deleted "Category:Placentalia" (content was: '[[Category:Mammalia]]')
- 16:51, 10 Jun 2004 UtherSRG deleted "Category:Canidae" (content was: '[[Category:Carnivora]]')
- 16:49, 10 Jun 2004 UtherSRG deleted "Category:Canis" (content was: '[[Category:Canidae]]')
- 16:46, 10 Jun 2004 Hadal deleted "Chococat" (content was: '[[Image:Example.jpg]][[Media:Example.ogg]]')
- 16:35, 10 Jun 2004 Hadal deleted "Jesse hofman" (content was: 'Jesse Hoffman was born with down syndrom because at birth fis dad screweed his mom and pownded him in the head with coused the birth defect of down sy...')
- 16:35, 10 Jun 2004 Hadal deleted "Eddie Wall" (content was: 'Jamesis the bigest faget in school.')
- 16:21, 10 Jun 2004 Hadal deleted "Meelar the Shit" (trash)
- 16:19, 10 Jun 2004 Hadal deleted "James Guy" (content was: 'James Guy wasborn out of eddie's ass and has two fathers; Taylor Stein and Eddie Wall Eddie is the gayest of the twoand is the bitch who conceived Jam...')
- 15:37, 10 Jun 2004 Texture deleted "Wikipedia:Votes for deletion/Airport Parkway, et. al." (content was: '#REDIRECT [[Wikipedia:Votes for deletion/Airport Parkway et al]]')
- 15:34, 10 Jun 2004 Theresa knott restored "Dell'Arcano_del_Mare"
- 15:27, Jun 10, 2004 Dori deleted "Creek (waterway)" (content was: '== Headline text ==<nowiki>Insert non-formatted text here</nowiki>'''Bold text''''''Bold text'''--[[User:65.50.52.29|65.50.52.29]] 11:47, 10 Jun 200...')
- 15:23, 10 Jun 2004 Francs2000 deleted "User:82.34.83.208" (created in error)
- 15:21, Jun 10, 2004 Dori restored "Macrocosm_and_microcosm"
- 15:21, Jun 10, 2004 Dori deleted "Macrocosm and microcosm" (delete in prep for history merge, will restore)
- 15:20, 10 Jun 2004 Hadal deleted "Dennis Mitchell" (content was: 'Dennis er kul.')
- 15:06, 10 Jun 2004 Francs2000 deleted "Citânia de Santa Luzia" (content was: 'u r gay')
- 14:58, 10 Jun 2004 Meelar deleted "Pheasant kings" (nonsense--content will go to [[BJAODN]])
- 14:48, 10 Jun 2004 Chris 73 deleted "Positive thinking" (content was: 'in my estimation positive thinking is ones own personal mindset to truly believe that his or hers own abilities are absolute. The ability is conjured ...')
- 14:41, 10 Jun 2004 Meelar deleted "Schiller Institute" (make way for original content)
- 14:39, 10 Jun 2004 Meelar deleted "Helga Zepp-LaRouche" (make way for original content)
- 14:22, 10 Jun 2004 DavidWBrooks deleted "Cross sex position" (copy vio)
- 13:59, 10 Jun 2004 Jimfbleak deleted "Clontarf (Ireland)" (content was: ''''Clontarf''' is the home of the two most notorious criminals in [[Ireland]], namely [[Gerry Ryan]] and [[the Monk]].')
- 13:56, 10 Jun 2004 Jimfbleak deleted "History of modern science" (content was: 'A brief history of moern science')
- 13:55, 10 Jun 2004 Jimfbleak deleted "FK Partizani" (content was: ' ''')
- 13:55, 10 Jun 2004 Jimfbleak deleted "Lucht druk" (content was: 'Hallo ik ben jan en ik wooon in nederland')
- 13:31, 10 Jun 2004 Texture deleted "Leonisvaldo" (nonsense/user test)
- 12:43, 10 Jun 2004 Sjc deleted "Grímnismál" (content was: '#redirect [[Grimnismal]]' - double redirect eliminated)
- 12:40, 10 Jun 2004 UtherSRG deleted "Category:Coca-cola brands" (content was: 'Brands of the [[Coca-Cola]] company')
- 12:07, 10 Jun 2004 UtherSRG deleted "Category:Anti-infectives" (content was: '[[category:Pharmacologic agents]]')
- 11:46, 10 Jun 2004 UtherSRG deleted "User:Leland Scruby/monobook.css" (content was: '{(delete)}')
- 11:41, 10 Jun 2004 UtherSRG deleted "Category:Fictional cowboys" (content was: '[[Category:Fictional characters]]')
- 11:41, 10 Jun 2004 UtherSRG deleted "Category:Airports of China" (content was: ':''This page has been listed on [[Wikipedia:Votes for deletion]]. Please see [[Wikipedia:Votes_for_deletion#{(PAGENAME)}|its entry on that page]] for ...')
- 11:37, 10 Jun 2004 Danny deleted "Edward G. Rendell"
- 10:51, 10 Jun 2004 Hadal deleted "Pigging" (nonsensical neologism)
- 10:50, 10 Jun 2004 Hadal deleted "Piging" (nonsensical neologism)
- 10:46, 10 Jun 2004 Dysprosia deleted "Named pipes" (content was: '#REDIRECT [[Pipe (computing)]]' - to move)
- 10:33, 10 Jun 2004 Hadal deleted "Marcel" (content was: '{(delete)}Synonym for hero')
- 10:33, 10 Jun 2004 Hadal deleted "Marcel" (content was: 'Synonym for hero')
- 10:22, 10 Jun 2004 Gentgeen deleted "Dr. Jose Rizal" (content was: 'His Real Name was Timothy Escopete of USLS...Thank you po')
- 09:41, 10 Jun 2004 Pcb21 deleted "Alykhan Velshi" (vfd consensus)
- 09:41, 10 Jun 2004 Pcb21 deleted "The Beaver" (vfd consenus - yes people voted to delete this but keep a page about a mindnumbingly trivial detail about one aspect of a one computer game - systematic bias anyone?)
- 09:40, 10 Jun 2004 Pcb21 deleted "Springfield Paradox" (vfd consensus)
- 09:35, 10 Jun 2004 Pcb21 deleted "CustomizedGirl" (content was: '{(msg:vfd)}CustomizedGirl is a privately held company based in Columbus, Ohio. The online retailer sells clothing solely through its interactive fas...')
- 09:35, 10 Jun 2004 Pcb21 deleted "Andy Hagans" (content was: '{(msg:vfd)}'''Andy Hagans''' is currently one of the web's leading [[SEO]] consultants and a graduate from the [[University of Notre Dame]]. He is a...')
- 08:35, 10 Jun 2004 Maximus Rex deleted "User talk:RickK•" (impostor)
- 08:34, 10 Jun 2004 Maximus Rex deleted "User:RickK•" (impostor)
- 08:26, 10 Jun 2004 Snoyes deleted "Nintendo Wars" (content was: 'Maybe its like advance wars, only with nintendos.')
- 08:24, 10 Jun 2004 Hadal deleted "Alexanders" (content was: 'HAHAHAHAHAHAHAAHAHAH--[[User:202.84.223.164|202.84.223.164]] 08:23, 10 Jun 2004 (UTC)----[[Link title]]''Italic text'''''Bold text'''uu7jytujyjuyhfu...')
- 08:24, 10 Jun 2004 Hadal deleted "Nintendo Wars" (content was: ''''Bold text'''BOLD TEXT'''Bold text'''')
- 08:15, 10 Jun 2004 Chris 73 deleted "Penis bird" (content was: 'Apparently this has become a pretty widespread phrase on the Internet. It refers to a picture originally posted on [http://www.rotten.com] of a parrot...')
- 08:13, 10 Jun 2004 Chris 73 deleted "Tsoureki" (content was: 'a buttery, Greek Easter cookie')
- 08:13, 10 Jun 2004 Chris 73 deleted "Reactive hypoglycaemia" (content was: 'Reactive hypoglycaemia')
- 07:56, 10 Jun 2004 Hadal deleted "C206 time displacement" (I don't think this was speedy-deleteable, but I recreated it by mistake, so what do I know?)
- 07:50, 10 Jun 2004 Chris 73 deleted "C206 time displacement" (Redundant with [[John Titor]])
- 07:46, 10 Jun 2004 Hadal deleted "Juggalos" (content was: '{(msg:delete)}[http://www.insaneclownposse.com]')
- 07:31, 10 Jun 2004 Hadal deleted "Mike Binder" (content was: 'nipple dick fart fart breath penis vagina')
- 06:48, Jun 10, 2004 Jmabel deleted "List of detective authors" (Duplicated better-titled [[List of detective fiction authors]])
- 06:41, 10 Jun 2004 Chris 73 deleted "Image:The mall london totc 280px.jpg" (deleted on request)
- 06:37, 10 Jun 2004 Chris 73 deleted "Image:WikipediaSidebarTypeLogo.PNG" (deleted on request)
- 06:27, Jun 10, 2004 Jmabel deleted "Order of the Crown" (content was: '--[[User:24.168.16.211|24.168.16.211]]''Italic text'''''Bold text'''[http://www.example.com link title]== Headline text ==--------~[[Media:Examp...')
- 06:20, 10 Jun 2004 Jiang deleted "Sing Sing" (prepare for move)
- 06:19, 10 Jun 2004 Guanaco deleted "Talk:Foot fetishism" (content was: 'There's nothing like a small, high arched female bare foot in your face 24 hours a day !')
- 06:17, 10 Jun 2004 Guanaco deleted "User:JRR Trollkien/Legion of Trolls" (created by banned user EofT)
- 06:08, Jun 10, 2004 Delirium deleted "Mavis Hutchinson/Temp" (content was: '#REDIRECT [[Mavis Hutchinson]]')
- 05:49, 10 Jun 2004 Guanaco deleted "Talk:Havamal" (created by banned user)
- 05:47, 10 Jun 2004 Guanaco deleted "Rígsþula" (created by banned user)
- 05:47, 10 Jun 2004 Guanaco deleted "Ecosystem valuation" (created by banned user)
- 05:46, 10 Jun 2004 Guanaco deleted "Distrust" (created by banned user; reinstated by same banned user)
- 05:43, Jun 10, 2004 Delirium deleted "VHS" (deleting article whose only history is some redirects to prepare for a move)
- 05:42, Jun 10, 2004 Raul654 deleted "Charles Colson" (content was: '#REDIRECT [[Charles W. Colson]]')
- 05:25, 10 Jun 2004 Cyrius deleted "User:Cyrius/Sandbox/Template" (failed test)
- 05:17, 10 Jun 2004 Niteowlneils deleted "Rust Belt" (content was: '#REDIRECT [[Rust belt]]' to move article here--much more common to cap US "Belts))
- 05:14, Jun 10, 2004 RickK deleted "Srinivas" (content was: '== '''Srinivas is one of the greatest sick ass on the surface of the earth..................u better know him.............srinivas a stupid student f...')
- 05:12, Jun 10, 2004 RickK deleted "Srinivas" (content was: 'Srinivas is one of the greatest sick ass on the surface of the earth..................u better know him.............srinivas a stupid student from ......')
- 05:11, 10 Jun 2004 Niteowlneils deleted "Bible Belt" (content was: '#REDIRECT [[Bible belt]]' to move article here--much more common to cap US "belt"s)
- 05:09, 10 Jun 2004 Meelar deleted "Mike Binder" (content was: 'Well nipple apple fart qaudriateral penis breath fart weiner dumb hoochie cooch banana')
- 04:57, Jun 10, 2004 RickK deleted "Mike Binder" (content was: 'nipple nipple apple penis fart breath')
- 04:42, Jun 10, 2004 RickK deleted "User:Michaeltran" (content was: 'I hope to appear smarter than I am. I have an IQ of 30.')
- 04:38, 10 Jun 2004 Maximus Rex deleted "Dashiell dunn" (nonsense: content was: ''''DASHIELL DUNN'''Dashiell Dunn was an ancient historian.He lived from 1495 to 1550. He recorded everything about games. His recordings are being ...')
- 04:36, 10 Jun 2004 Maximus Rex deleted "David wang" (content was: '{(delete)}'''DAVID WANG'''David Wang is a story about an Asian boy and school life.Find it at www.thedavidwangstory.com')
- 04:22, 10 Jun 2004 Maximus Rex deleted "Supershadow" (content was: 'Supershadow is the greatest Star Wars site in the world! It has all correct info on the upcoming Star Wars movies.')
- 03:40, 10 Jun 2004 Guanaco deleted "American Idiot" (page by Michael)
- 03:37, 10 Jun 2004 Maximus Rex deleted "Locational" (content before blanking was: 'May I please have the latitude and longitude of New York City. I need this information to submit to my class.')
- 03:37, 10 Jun 2004 Chris 73 deleted "Tuao, Cagayan" (content was: '{(delete)}hi kayo dyan, my peaople from tuao, cagayan, kumusta ngin??')
- 03:35, 10 Jun 2004 Maximus Rex deleted "Mojoman" (content was: 'aaron is mojo! mojoman@gmail.com')
- 03:33, 10 Jun 2004 Maximus Rex deleted "David wang" (nonsense)
- 03:28, 10 Jun 2004 Hadal deleted "Category:United States cities" (requested by author; content was: '{(delete)}')
- 03:23, 10 Jun 2004 Texture deleted "Ramasee" (content was: 'Ramasee is/was the secret language or argot of the Thuggee cultists in India.Examples of such language could not be found by the author, and books on...')
- 03:00, 10 Jun 2004 Texture deleted "User:Topbanana/Reports/This articles links to a redirect back to itself" (content was: '{(msg:delete)}' - user request)
- 03:00, 10 Jun 2004 Maximus Rex deleted "Skullet" (content was: 'A Skullet is trashy haircut that resembles a Mullet except the individual is bald on the top and long hair on the back. Al my driver instructor had a ...')
- 02:29, 10 Jun 2004 Maximus Rex deleted "User talk:Jíang" (impostor)
- 02:28, 10 Jun 2004 Guanaco deleted "User:Jíang" (impostor userpage)
- 02:18, 10 Jun 2004 Stan Shebs deleted "Ica Department)" (content was: '#REDIRECT [[Ica Department]]', we'll never need this one)
- 01:39, 10 Jun 2004 Jiang deleted "British 6th Airborne Division/Temp" (content was: '#REDIRECT [[British 6th Airborne Division]]')
- 01:39, 10 Jun 2004 Jiang restored "British_6th_Airborne_Division"
- 01:38, 10 Jun 2004 Jiang deleted "British 6th Airborne Division" (merging)
- 01:37, 10 Jun 2004 Guanaco deleted "²Armed Love²" (page by Michael)
- 01:36, 10 Jun 2004 Jiang deleted "Bojan Dimitrijevic/Temp" (copied to [[Bojan Dimitrijevic]] by sole contributor; orphaned)
- 01:35, 10 Jun 2004 Jiang deleted "Akbayan! Citizens' Action Party/Temp" (content was: '#REDIRECT [[Akbayan! Citizens' Action Party]]')
- 01:33, Jun 10, 2004 Raul654 deleted "Noctiswiki" (Already exists at Noctis)
- 01:31, 10 Jun 2004 Jiang deleted "Tomica Milosavljevic/Temp" (copied over to [[Tomica Milosavljevic]] by original contributor)
- 01:27, 10 Jun 2004 UtherSRG deleted "Category:Central American Countries" (content was: 'Do NOT use this category — see [[:Category:Central American countries]] instead.')
- 01:12, 10 Jun 2004 Timwi deleted "MediaWiki:Monobook.js" (oops! didn't mean to put it here)
- 00:35, 10 Jun 2004 Francs2000 deleted "Gaia (planet)" (content was: 'yup here it goes.')
- 00:27, 10 Jun 2004 Francs2000 deleted "Esham" (content was: 'see. Mehmet Genç, 'Esham,' Encyclopedia of Islam (Diyanet), İstanbul 1995, pp. 376-80.')
- 00:27, 10 Jun 2004 Francs2000 deleted "Varroa" (content was: 'Scientific Name: Varroa jacobsoni[[http://creatures.ifas.ufl.edu/misc/bees/varroa_mite.htm]]')
- 00:00, Jun 10, 2004 RickK deleted "The 69 Boyz" (content was: 'I dont know what you been told but its not tha butterfly its tha tootsie roll!!!!!!!!!!!!')
- 23:56, 9 Jun 2004 Chris 73 deleted "Wikipedia:Deletion requests/mock-up/User:Rossami" (deleted upon request )
- 23:56, 9 Jun 2004 Chris 73 deleted "Template:/User:Rossami" (deleted upon request content was: '{(ed|/User:Rossami|this discussion)}test 3')
- 23:54, 9 Jun 2004 Tom- deleted "Category:United States bridges" (Superseded by [[Category:Bridges in the United States]])
- 23:48, 9 Jun 2004 Texture deleted "Victoria College in Texas" (content was: '{(msg:delete)}<math>Insert formula here</math>324--[[User:69.142.145.142|69.142.145.142]] 23:08, 9 Jun 2004 (UTC)nbbnm----fhb== Headline text ==...')
- 23:48, 9 Jun 2004 Texture deleted "Borgify" (content was: '{(msg:delete)}Jocular word inspired by a fictitious race called the Borg in the television show Star Trek: The Next Generation. To borgify something...')
- 23:38, 9 Jun 2004 UtherSRG deleted "Category:Subculture" (content before blanking was: '[[Category:Culture]]')
- 23:34, Jun 9, 2004 RickK deleted "Georg Ladanyi" (nonsense. Looks like an interview, oddly capitalized, not an encyclopedia article)
- 23:21, 9 Jun 2004 Dysprosia deleted "Talk:Elijah Wood" (content was: '== Headline text ==hello -xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx-')
- 23:16, 9 Jun 2004 Texture deleted "Lecnacing" (content was: '{(msg:delete)}The opposite of cancelling a fraction. Please see 'lecnac' for further details.')
- 23:02, Jun 9, 2004 RickK deleted "Love Is Hell pt. 2" (content was: '1. MY BLUE MANHATTAN2. PLEASE DO NOT LET ME GO 3. CITY RAIN, CITY STREETS4. I SEE MONSTERS5. ENGLISH GIRLS APROXIMATELY6. THANK YOU LOUISE7. HOT...')
- 23:00, 9 Jun 2004 Tom- deleted "Parliamentary monarchy" (content was: '{(msg:delete)}Great Britain is a parliamentary monarchy.')
- 22:43, 9 Jun 2004 Tom- deleted "Rococo architecture" (content was: '{(msg:delete)}bloody hell')
- 22:43, 9 Jun 2004 Tom- deleted "Hippopotomonstrosesquippedaliophobia" (content was: '{(msg:delete)}Lmao. I'm pretty sure this one is a joke. :)')
- 22:43, 9 Jun 2004 Tom- deleted "Gothic alphabet/Temp" (Nonsense test page)
- 22:42, 9 Jun 2004 Maximus Rex deleted "Hipmeister" (content was: 'A hipmeister is a person who thinks that they are socially revered.{(stub)}')
- 22:42, 9 Jun 2004 Tom- deleted "Willie Mak" (Nonsense test page)
- 22:42, 9 Jun 2004 Tom- deleted "Anti-government sentiment" (content was: '{(msg:delete)}'''Bold text'''')
- 22:42, 9 Jun 2004 Maximus Rex deleted "Sniz and Fondue" (content was: '{(msg:delete)}sniz and fondue... woot woot<math>Insert formula here</math>')
- 22:41, 9 Jun 2004 Tom- deleted "The Gaze" (content was: '{(msg:delete)}The gaze is bs.')
- 22:40, 9 Jun 2004 Tom- deleted "WJW" (Advertising)
- 22:40, 9 Jun 2004 Tom- deleted "WKYC" (Advertising)
- 22:40, 9 Jun 2004 Tom- deleted "WTOV" (Advertising)
- 22:40, 9 Jun 2004 Dysprosia deleted "Mandrakelinux" (to move - (see my talk page) - content was: '#REDIRECT [[Mandrake Linux]]')
- 22:40, 9 Jun 2004 Tom- deleted "LeRoy Johnson" (content was: '{(delete)}search under, L F Johnson professor')
- 22:12, Jun 9, 2004 Merovingian deleted "Xam language" (content was: '#REDIRECT: [[/Xam language]]')
- 21:51, 9 Jun 2004 Mic deleted "Sami language" (content was: '#REDIRECT [[Sami languages]]')
- 21:44, 9 Jun 2004 Charles Matthews deleted "Colocation Centre" (content before blanking was: 'test')
- 21:33, 9 Jun 2004 Mic deleted "Category:Scandinavian languages" (Superceded by [[Category:North Germanic languages]])
- 21:30, Jun 9, 2004 Merovingian deleted "Gear/Richie Foley" (broken redir)
- 21:10, 9 Jun 2004 Finlay McWalter deleted "University of Stirling" (reversing direction of redirect)
- 20:45, 9 Jun 2004 Ahoerstemeier deleted "Parliamentary Question" (content was: 'what about the leader of the oppisition and what does he do?')
- 20:18, 9 Jun 2004 Wile E. Heresiarch deleted "Hipmeistology" (patent nonsense, deleted before (May 31 2004))
- 20:15, 9 Jun 2004 Jrdioko deleted "Oberboihingen" (content was: 'I am seeking information on the Euchner surname from the Oberboihingen region around the 1800-1860. My G-G-Grandfather John was born about 1839 and i...' (contents moved to [[WP:RD]]))
- 20:03, 9 Jun 2004 Jrdioko deleted "Spray gun" (content was: '{(delete)}where is the information')
- 19:59, 9 Jun 2004 Jrdioko deleted "Angelina Johnson" (content was: '{(delete)}Becomes')
- 19:55, 9 Jun 2004 Jrdioko deleted "Faust Part 2" (content was: '{(delete)}God I'm awseome')
- 19:32, 9 Jun 2004 Mic restored "MiniDisc"
- 19:30, 9 Jun 2004 Mic deleted "MiniDisc" (Merging page histories, back soon)
- 19:20, 9 Jun 2004 Charles Matthews deleted "Kutnerd" (content was: 'Dennis janssen')
- 19:19, 9 Jun 2004 Guanaco deleted "Shaniwar Wada" (listed as copyvio for over 7 days)
- 19:19, 9 Jun 2004 Guanaco deleted "Adeje, Santa Cruz de Tenerife" (listed as copyvio for over 7 days)
- 19:19, 9 Jun 2004 Guanaco deleted "Harold Ickes" (listed as copyvio for over 7 days)
- 19:19, 9 Jun 2004 Guanaco deleted "National Society of Professional Engineers" (listed as copyvio for over 7 days)
- 19:19, 9 Jun 2004 Guanaco deleted "Free Patriotic Movement (Lebanon)" (listed as copyvio for over 7 days)
- 19:18, 9 Jun 2004 Guanaco deleted "Dmitri Baltermants" (listed as copyvio for over 7 days)
- 19:12, 9 Jun 2004 Guanaco deleted "Tad" (listed as copyvio for over 7 days)
- 19:12, 9 Jun 2004 Guanaco deleted "Vlad III Dracula" (listed as copyvio for over 7 days)
- 19:11, 9 Jun 2004 Guanaco deleted "Scream (band)" (listed as copyvio for over 7 days)
- 19:11, 9 Jun 2004 Guanaco deleted "James Somerville" (listed as copyvio for over 7 days)
- 19:11, 9 Jun 2004 Guanaco deleted "Operation Sundevil" (listed as copyvio for over 7 days)
- 19:11, 9 Jun 2004 Guanaco deleted "J-2 (rocket engine)" (listed as copyvio for over 7 days)
- 19:11, 9 Jun 2004 Guanaco deleted "F-1 (rocket engine)" (listed as copyvio for over 7 days)
- 19:11, 9 Jun 2004 Guanaco deleted "Humber College of Applied Arts and Technology" (listed as copyvio for over 7 days)
- 19:10, 9 Jun 2004 Guanaco deleted "Leigh Howard Stevens" (listed as copyvio for over 7 days)
- 19:10, 9 Jun 2004 Guanaco deleted "Rubberband Man" (listed as copyvio for over 7 days)
- 19:10, 9 Jun 2004 Guanaco deleted "E. K. Nayanar" (listed as copyvio for over 7 days)
- 19:10, 9 Jun 2004 Guanaco deleted "The Legacy" (listed as copyvio for over 7 days)
- 19:10, 9 Jun 2004 Guanaco deleted "Rise of Hitler" (listed as copyvio for over 7 days)
- 19:10, 9 Jun 2004 Guanaco deleted "Mahanta" (listed as copyvio for over 7 days)
- 19:06, 9 Jun 2004 Guanaco deleted "Lorne" (listed as copyvio for over 7 days)
- 19:06, 9 Jun 2004 Guanaco deleted "Principal wood" (listed as copyvio for over 7 days)
- 19:06, 9 Jun 2004 Guanaco deleted "Anti-Semitism: The New Anti-Semitism" (listed as copyvio for over 7 days)
- 19:05, 9 Jun 2004 Guanaco deleted "Joseph F. Engelberger" (listed as copyvio for over 7 days)
- 19:05, 9 Jun 2004 Guanaco deleted "Image:Edgar Davids.jpg" (listed as copyvio for over 7 days)
- 19:05, 9 Jun 2004 Guanaco deleted "Piae Cantiones" (listed as copyvio for over 7 days)
- 19:05, 9 Jun 2004 Guanaco deleted "Melasse" (listed as copyvio for over 7 days)
- 19:05, 9 Jun 2004 Guanaco deleted "Rav Yitzchak Alfasi" (listed as copyvio for over 7 days)
- 19:05, 9 Jun 2004 Guanaco deleted "Rabbeinu Chananel" (listed as copyvio for over 7 days)
- 18:55, 9 Jun 2004 Guanaco deleted "Jonina Dourif" (listed as copyvio for over 7 days)
- 18:55, 9 Jun 2004 Guanaco deleted "PARFUDREZ" (listed as copyvio for over 7 days)
- 18:54, 9 Jun 2004 Guanaco deleted "Victoria Pratt" (listed as copyvio for over 7 days)
- 18:54, 9 Jun 2004 Guanaco deleted "Busytown" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Institute for Astronomy" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Image:UHIfA.jpeg" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Lancia Y10" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Lancia Stratos" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Image:Fpj.jpg" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Image:Ctd.jpeg" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Image:Roco.jpeg" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Image:Ople1.jpg" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Image:Noel Redding.jpg" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Image:Marcosinauguration1965.jpeg" (listed as copyvio for over 7 days)
- 18:51, 9 Jun 2004 Guanaco deleted "Image:18010592.jpg" (listed as copyvio for over 7 days)
- 18:50, 9 Jun 2004 Guanaco deleted "Rolf Eckrodt" (listed as copyvio for over 7 days)
- 18:50, 9 Jun 2004 Guanaco deleted "Carlos Ghosn" (listed as copyvio for over 7 days)
- 18:50, 9 Jun 2004 Guanaco deleted "Francesco Benvenuto" (listed as copyvio for over 7 days)
- 18:50, 9 Jun 2004 Guanaco deleted "Chevrolet Aveo" (listed as copyvio for over 7 days)
- 18:50, 9 Jun 2004 Guanaco deleted "Angola 3" (listed as copyvio for over 7 days)
- 18:49, 9 Jun 2004 Guanaco deleted "Michoud Assembly Facility" (listed as copyvio for over 7 days)
- 18:49, 9 Jun 2004 Guanaco deleted "Hong Kong Shue Yan College" (listed as copyvio for over 7 days)
- 18:49, 9 Jun 2004 Guanaco deleted "Kappa Alpha Order" (listed as copyvio for over 7 days)
- 18:49, 9 Jun 2004 Guanaco deleted "Francois Gautier" (listed as copyvio for over 7 days)
- 18:49, 9 Jun 2004 Guanaco deleted "Costa surface" (listed as copyvio for over 7 days)
- 18:47, 9 Jun 2004 Guanaco deleted "Mohammed Ayoob" (listed as copyvio for over 7 days)
- 18:47, 9 Jun 2004 Guanaco deleted "Bodenstein number" (listed as copyvio for over 7 days)
- 18:47, 9 Jun 2004 Guanaco deleted "Image:Biharhungary.jpg" (listed as copyvio for over 7 days)
- 18:47, 9 Jun 2004 Ahoerstemeier deleted "Narathiwat" (content was: '#REDIRECT [[Narathiwat_province]]' - wrong redirect)
- 18:41, 9 Jun 2004 Guanaco deleted "Boags" (listed as copyvio for over 7 days)
- 18:41, 9 Jun 2004 Guanaco deleted "Pantoto" (listed as copyvio for over 7 days)
- 18:41, 9 Jun 2004 Guanaco deleted "Mikhail Voronin" (listed as copyvio for over 7 days)
- 18:41, 9 Jun 2004 Guanaco deleted "Haidong Gumdo" (listed as copyvio for over 7 days)
- 18:41, 9 Jun 2004 Guanaco deleted "Mirza Masroor Ahmad" (listed as copyvio for over 7 days)
- 18:41, 9 Jun 2004 Guanaco deleted "Guy colwell" (listed as copyvio for over 7 days)
- 18:41, 9 Jun 2004 Guanaco deleted "Roger W. Straus, Jr." (listed as copyvio for over 7 days)
- 18:41, 9 Jun 2004 Guanaco deleted "Dux Ryu" (listed as copyvio for over 7 days)
- 18:41, 9 Jun 2004 Guanaco deleted "Report by the Federation Sociological Research Institute regarding the Klingon Species" (listed as copyvio for over 7 days)
- 18:40, 9 Jun 2004 Guanaco deleted "Su-22" (listed as copyvio for over 7 days)
- 18:40, 9 Jun 2004 Guanaco deleted "Dunlop Tyre Company" (listed as copyvio for over 7 days)
- 18:40, 9 Jun 2004 Guanaco deleted "Owen Josephus Roberts" (listed as copyvio for over 7 days)
- 18:40, 9 Jun 2004 Guanaco deleted "Cascade (beer)" (listed as copyvio for over 7 days)
- 18:40, 9 Jun 2004 Guanaco deleted "Bocaue, Bulacan" (listed as copyvio for over 7 days)
- 18:40, 9 Jun 2004 Guanaco deleted "Tay Wilson" (listed as copyvio for over 7 days)
- 18:40, 9 Jun 2004 Guanaco deleted "Sri Ramanujacharya" (listed as copyvio for over 7 days)
- 18:37, 9 Jun 2004 Guanaco deleted "Dell'Arcano del Mare" (listed as copyvio for over 7 days)
- 18:37, 9 Jun 2004 UtherSRG deleted "A&W Advertising Schemes"
- 18:37, 9 Jun 2004 Guanaco deleted "Thinkism" (listed as copyvio for over 7 days)
- 18:37, 9 Jun 2004 Guanaco deleted "Shoji Hamada" (listed as copyvio for over 7 days)
- 18:36, 9 Jun 2004 Guanaco deleted "Almendra" (listed as copyvio for over 7 days)
- 18:36, 9 Jun 2004 Guanaco deleted "Image:1043031531 10.jpg" (listed as copyvio for over 7 days)
- 18:36, 9 Jun 2004 Guanaco deleted "Maronite Christians" (listed as copyvio for over 7 days)
- 18:36, 9 Jun 2004 Guanaco deleted "Key Performance Indicators" (listed as copyvio for over 7 days)
- 18:36, 9 Jun 2004 Guanaco deleted "Metrics" (listed as copyvio for over 7 days)
- 18:35, 9 Jun 2004 Guanaco deleted "Javier Batiz" (listed as copyvio for over 7 days)
- 18:35, 9 Jun 2004 Guanaco deleted "Madhva" (listed as copyvio for over 7 days)
- 18:34, 9 Jun 2004 Guanaco deleted "Biogeology" (listed as copyvio for over 7 days)
- 18:34, 9 Jun 2004 Guanaco deleted "Semantic prosody" (listed as copyvio for over 7 days)
- 18:34, 9 Jun 2004 Guanaco deleted "Nodachi" (listed as copyvio for over 7 days)
- 18:34, 9 Jun 2004 UtherSRG deleted "America’s Dates with Destiny" (content was: '{(msg:delete)}Meaningless drivel from a sick man')
- 18:32, 9 Jun 2004 UtherSRG deleted "Larry O'Brien" (content was: '{(msg:delete)}BOOBS')
- 18:31, 9 Jun 2004 UtherSRG deleted "Culture of Uzbekistan" (content was: '{(msg:delete)}I am doing a report on Uzbekistan for my high school final and your website has been very helpful with information that I never knew e...')
- 18:30, 9 Jun 2004 UtherSRG deleted "Desenrascanço" (content was: '{(delete)}habilidade individual relacionada com tacticas improvizadas que levam ao desenvencilhar de uma situacao imprevista')
- 18:25, 9 Jun 2004 Guanaco deleted "Image:Oswestry.jpg" (listed as copyvio for over 7 days)
- 18:23, 9 Jun 2004 Guanaco deleted "Image:Old oswestry.jpg" (listed as copyvio for over 7 days)
- 18:21, 9 Jun 2004 Guanaco deleted "User:JRR Trollkien/Wiki Watch" (listed as copyvio for over 7 days)
- 18:18, 9 Jun 2004 Charles Matthews deleted "2117" (nonsense content was: '2117 A.D.Suprisingly society is thriving, after decades of tumult, chemical disastors, earthquakes, and the like, a platinum era of peace has arrive...')
- 18:16, 9 Jun 2004 Guanaco deleted "List of SAT words" (content was: '{(copyvio1)}: http://www.freevocabulary.com{(copyvio2)}[[User:Wile E. Heresiarch|Wile E. Heresiarch]] 07:26, 2 May 2004 (UTC)')
- 18:09, 9 Jun 2004 Guanaco deleted "Colin Lucas" (listed as copyvio for over 7 days)
- 18:08, 9 Jun 2004 Guanaco deleted "Milestone Media" (listed as copyvio for over 7 days)
- 18:08, 9 Jun 2004 Guanaco deleted "Ko Samui/temp" (content was: '#REDIRECT [[Ko Samui]]')
- 18:08, 9 Jun 2004 Guanaco deleted "HARDWARE" (listed as copyvio for over 7 days)
- 18:08, 9 Jun 2004 Guanaco deleted "International Baccalaureate Computer Science" (listed as copyvio for over 7 days)
- 18:08, 9 Jun 2004 Guanaco deleted "Talk:Ko Samui/temp" (content was: '#REDIRECT [[Talk:Ko Samui]]')
- 18:07, 9 Jun 2004 Guanaco deleted "SunTrust Bank" (listed as copyvio for over 7 days)
- 18:07, 9 Jun 2004 Guanaco deleted "Musicflex" (listed as copyvio for over 7 days)
- 18:06, 9 Jun 2004 Guanaco deleted "Talk:Ko Samui" (content was: 'I have written an expanded version of this page at [[Ko Samui/temp]] but I do not use any of the copyrighted material. If this page turns out to not b...')
- 18:05, 9 Jun 2004 Guanaco deleted "Ko Samui" (listed as copyvio for over 7 days)
- 18:01, 9 Jun 2004 Guanaco deleted "Veerapandya Kattabomman" (listed as copyvio for over 7 days)
- 18:01, 9 Jun 2004 Guanaco deleted "Ayinla Omowura" (listed as copyvio for over 7 days)
- 18:01, 9 Jun 2004 Guanaco deleted "Death Guard" (listed as copyvio for over 7 days)
- 17:59, 9 Jun 2004 Guanaco deleted "Thousand Sons" (listed as copyvio for over 7 days)
- 17:59, 9 Jun 2004 Guanaco deleted "Night Lords" (listed as copyvio for over 7 days)
- 17:59, 9 Jun 2004 Guanaco deleted "Iron Warriors" (listed as copyvio for over 7 days)
- 17:59, 9 Jun 2004 Guanaco deleted "Emperor's Children" (listed as copyvio for over 7 days)
- 17:59, 9 Jun 2004 Guanaco deleted "World Eaters" (listed as copyvio for over 7 days)
- 17:41, 9 Jun 2004 Guanaco deleted "George Sudarsan" (content was: 'Dr. George Sudarsan, Texas, USA')
- 17:32, 9 Jun 2004 Maximus Rex deleted "Raymond Usher" (content was: '{(msg:delete)}d== Headline text ==<nowiki>Insert non-formatted text here</nowiki>--[[User:206.245.176.107|206.245.176.107]] 14:07, 9 Jun 2004 (UTC)...')
- 17:32, 9 Jun 2004 Maximus Rex deleted "Tony Lovello" (content was: 'http://www.accordionmusic.com/')
- 17:20, 9 Jun 2004 Deb deleted "CRITICAL MASS"
- 16:43, 9 Jun 2004 Guanaco deleted "User:Guanaco/monobook.css"
- 16:37, 9 Jun 2004 Guanaco deleted "User:Guanaco/standard.css"
- 16:33, 9 Jun 2004 DavidWBrooks deleted "Chubby" (content was: 'fat, round, over-weight')
- 16:18, Jun 9, 2004 Zanimum deleted "Street Theatre" (content was: '{(msg:delete)}blacktheatreindia is a small resource team for giving training on street theatre in tamilnadu india.for details contact blacktheatrein...')
- 16:18, 9 Jun 2004 Dpbsmith deleted "Miguel Rosario" (User:Mrosarionyc created this page, moved it to User:Mrosarionyc, then blanked it, so I consider that tacit permission/request to delete)
- 15:47, Jun 9, 2004 Zanimum deleted "Bonauo" (content was: 'Bonao')
- 15:09, Jun 9, 2004 Zanimum deleted "Damian Gonzalez" (content was: 'Christopher Colombus')
- 15:05, 9 Jun 2004 DavidWBrooks deleted "Colombey-les-deux-Églises" (content was: '{(delete)}Colombey-les-deux-Églises sounds like a city of some sort, probably in France.')
- 15:05, 9 Jun 2004 DavidWBrooks deleted "Battle Of The Plains Of Abraham" (content was: 'this website is extraordinarely GAY!')
- 14:29, 9 Jun 2004 Robert Merkel deleted "Robert Merkel" (Old redirect from 2002 days, no longer standard practice.)
- 14:00, 9 Jun 2004 UtherSRG deleted "Brendon Smith" (content was: '{(delete)}http://SeaCloud9.org This web site is dedicated to the latest technological advancements, open source code, and cutting edge multimedia ar...')
- 13:57, 9 Jun 2004 Pcb21 deleted "User:Pcb21" (content was: '#REDIRECT [[User_talk:Pcb21]]')
- 13:13, 9 Jun 2004 Angela deleted "Baron Rutherford" (content was: '{(delete)}HMMMMM...')
- 12:14, 9 Jun 2004 UtherSRG deleted "Topbanana/Offline" (content was: '{(msg:delete)}')
- 11:31, 9 Jun 2004 Angela deleted "Jimmy Atkinson" (listed on vfd for 5 days. Non-notable person)
- 11:29, 9 Jun 2004 Angela deleted "Runnin (Dying to Live)" (listed on VfD for a week)
- 11:24, 9 Jun 2004 Chris 73 deleted "Category:Districts in Fukuokaprefecture" (Typo content was: '[[Category:Fukuoka prefecture]]')
- 11:18, 9 Jun 2004 Tannin deleted "Kiwi" (just a pointlessly duplicated disambiguation page)
- 10:41, 9 Jun 2004 Chris 73 deleted "Marie Taglioni"
- 10:41, 9 Jun 2004 Chris 73 deleted "Macabebe" (content was: '{(delete)}A traitor, a spy.')
- 10:41, 9 Jun 2004 Chris 73 deleted "Prime Minister of Mauritius" (content was: '{(delete)}== Headline text ==paul berenger was a very old man when he was prime minister<nowiki>Insert non-formatted text here</nowiki>ui')
- 10:40, 9 Jun 2004 Chris 73 deleted "Szekszárd" (content was: '{(delete)}[[Image:Example.jpg]][[Link title]]<nowiki>Insert non-formatted text here</nowiki>[[Image:Example.jpg]]')
- 10:40, 9 Jun 2004 Chris 73 deleted "Dave Gilby" (content was: '{(delete)}Dave gilby is my uncle and is a kick arse drummer')
- 10:40, 9 Jun 2004 Chris 73 deleted "Mr. Sammler's Planet" (content was: '{(delete)}and that happens most of the time. When he goes swimming those things happen. A kind of use of language . And some other things that go ve...')
- 10:40, 9 Jun 2004 Chris 73 deleted "RealNetworks Music Store" (content was: '{(delete)}I purchased some DRM songs from music strore through network.Now I want to play those songs in portable device, what are the steps tha...')
- 10:37, 9 Jun 2004 Chris 73 deleted "User talk:SWAdair/Surname disambiguation" (deleted on request)
- 10:09, 9 Jun 2004 Jiang deleted "Translator service" (listed for deletion since may 5)
- 10:09, 9 Jun 2004 Jiang deleted "Translation technology" (listed for deletion since may 5)
- 10:08, 9 Jun 2004 Jiang deleted "Standalone translation programs" (listed for deletion since may 5)
- 10:05, 9 Jun 2004 Jiang deleted "Introduction to the Machine Translation" (listed for deletion since 5 May 2004 )
- 10:05, 9 Jun 2004 Jiang deleted "Content scanning" (listed for deletion since 5 May 2004 )
- 10:04, 9 Jun 2004 Jiang deleted "Automatic translation" (listed for deletion since 5 May 2004 )
- 10:03, 9 Jun 2004 Jiang deleted "EAMT" (copyvio listed 19:18, 7 May 2004 (UTC))
- 09:41, 9 Jun 2004 Jiang deleted "MediaWiki:Russian History Harmonization" (content was: '#redirect [[Template:Russian History Harmonization]]')
- 09:33, 9 Jun 2004 Dysprosia deleted "Red Hat CCM" (content was: '{(delete)}hello')
- 09:17, 9 Jun 2004 Dysprosia deleted "The Living End" (del to move - content was: '#REDIRECT [[The Living End (album)]]')
- 09:02, 9 Jun 2004 Pcb21 deleted "Template:APECm" (vfd consensus)
- 09:02, 9 Jun 2004 Pcb21 deleted "Template:NAMm" (vfd consensus)
- 09:01, 9 Jun 2004 Pcb21 deleted "Template:Table Sort Algorithms" (vfd consensus)
- 08:59, 9 Jun 2004 Pcb21 deleted "Battling companion" (vfd consensus)
- 08:59, Jun 9, 2004 Merovingian deleted "MicroC/OS-II" (content was: 'Please write something')
- 08:50, 9 Jun 2004 Pcb21 deleted "Plastic Assassins" (vfd consensus)
- 08:50, 9 Jun 2004 Pcb21 deleted "MG 131 machine gun" (vfd consensus)
- 08:49, 9 Jun 2004 Pcb21 deleted "Logical behaviorism" (vfd consensus)
- 08:49, 9 Jun 2004 Dysprosia deleted "Spam King" (content was: '----[[Link title]][[Image:Example.jpg]]<math>Insert formula here</math><nowiki>Insert non-formatted text here</nowiki>--[[User:80.97.53.14|80.97.53....')
- 08:42, 9 Jun 2004 Pcb21 deleted "Scalex" (vfd consensus)
- 08:41, 9 Jun 2004 Pcb21 deleted "Blog.com" (vfd consensus)
- 08:37, 9 Jun 2004 Pcb21 deleted "Electrodermal screening" (vfd consensus)
- 08:36, 9 Jun 2004 Gentgeen deleted "RS-485" (content was: 'whooooos the daddy!')
- 08:35, 9 Jun 2004 Pcb21 deleted "Pferdestärke" (vfd consensus, not english)
- 08:34, 9 Jun 2004 Pcb21 deleted "Tilki" (content was: '{(notenglish)}. Köpekgillerden, uzunluğu 90 cm, kuyruğu 30 cm kadar, ırklarına göre çeşitli renklerde olan, ağı...')
- 08:34, 9 Jun 2004 Pcb21 deleted "Knob" (vfd consensus)
- 08:34, 9 Jun 2004 Pcb21 deleted "Thomas William Finch" (content was: ':''This page has been listed on [[Wikipedia:Votes for deletion]]. Please see [[Wikipedia:Votes_for_deletion#{(PAGENAME)}|its entry on that page]] for ...')
- 08:32, 9 Jun 2004 Pcb21 deleted "Stirner (NationState)" (vfd consensus)
- 08:24, Jun 9, 2004 Merovingian deleted "European Commission of Human Rights" (content was: '{(delete)}')
- 08:24, Jun 9, 2004 Merovingian deleted "Timeline (film)" (content was: '{(msg:delete)}Timeline is about a guy who leaves his time generation to travel in the past.'FFFFFFUCCCCKKKK DA WIFFFFFEE!!'-George Hamilton')
- 08:23, Jun 9, 2004 Merovingian deleted "Category:Crop deities" (content was: '{(delete)}See [[:Category:Agricultural deities]] instead.')
- 08:23, Jun 9, 2004 Merovingian deleted "Category:Mathematics and Computer science" (content was: '{(delete)}')
- 08:22, Jun 9, 2004 Merovingian deleted "Alpha Tango Flying Service" (content was: '{(delete)}Alpha Tango is a flight school in San Antonio Texas that caters to mainly Mexican and Saudi Arabian/ Arabic foreign students. The equipmen...')
- 08:19, 9 Jun 2004 Pcb21 deleted "Krazyletter" (content was: '{(vfd)}Krazyletter is a newspaper of ICS, a school in Kirkland, WA. Unfortunately, it is an unofficial newspaper.Competitors: The Holey BabbleOf...')
- 08:16, 9 Jun 2004 Jfdwolff deleted "Syndrome X" (Make room for move from [[Syndrome X (cardiac)]])
- 08:15, 9 Jun 2004 Pcb21 deleted "Free game" (vfd consensus)
- 08:14, 9 Jun 2004 Pcb21 deleted "Dvd to wmv9" (vfd consensus)
- 08:13, 9 Jun 2004 Jfdwolff deleted "Metabolic syndrome" (make room for move from [[Syndrome X (metabolic)]])
- 08:12, 9 Jun 2004 Hadal deleted "Malacca Sultanate" (content was: 'xvhjcgvhk')
- 08:00, 9 Jun 2004 Pcb21 deleted "Iraq Liberation Act" (vfd consensus)
- 07:51, 9 Jun 2004 Jiang deleted "Anna may wong" (content was: 'Chinese-American film actress')
- 07:32, Jun 9, 2004 Delirium deleted "Honshu" (deleting article whose only history is some redirects to prepare for a move)
- 06:40, 9 Jun 2004 Maximus Rex deleted "Saya Tin" (content was: '{(msg:delete)}')
- 06:33, 9 Jun 2004 Maximus Rex deleted "Saya Tin" (content was: '[[Media:Example.ogg]][http://www.example.com link title]')
- 06:20, 9 Jun 2004 Chris 73 deleted "Blue ribbon" (was a responsiveness test by [[User:Atlastawake]], see [[Wikipedia:Votes for deletion]])
- 06:03, Jun 9, 2004 RickK deleted "Levantine Arabic" (content was: 'The area comprising most of Palestine, Syria, Lebanon, and Jordan.')
- 05:57, 9 Jun 2004 Jiang deleted "Southwest Jiaotong University/temp" (duplicates [[Southwest Jiaotong University/Temp]]')
- 05:53, Jun 9, 2004 RickK deleted "The Wealth of Nations: Book One, Chapter III" (content was: 'Division of Labor is limited by the extent of the market.')
- 05:49, Jun 9, 2004 RickK deleted "Manzini" (nonsense)
- 05:46, 9 Jun 2004 Guanaco deleted "Image:Chocobo.png" (uploaded by accident)
- 05:45, 9 Jun 2004 Guanaco deleted "Image:Approvalballotchoice.gif" (converted to PNG, orphaned)
- 05:44, 9 Jun 2004 Guanaco deleted "Image:Approvalballotmark.gif" (orphaned, converted to PNG)
- 05:44, 9 Jun 2004 Chris 73 deleted "Hoh Head" (content before blanking was: 'Neil G is a student of life, often working way too hard, and learning life's lessons the hard way.')
- 05:42, 9 Jun 2004 Guanaco deleted "Image:Approvalballotname.gif" (orphaned, converted to PNG)
- 05:41, 9 Jun 2004 Jiang deleted "Southwest Jiaotong University/Temp" (content same at [[Southwest Jiaotong University/temp]])
- 05:40, 9 Jun 2004 Jimfbleak deleted "Marvin Perry" (wrong content was: 'An actor best known for his portrayal of Chandler on ''Friends''')
- 05:38, 9 Jun 2004 Jimfbleak deleted "National Museum" (content was: '{(msg:delete)}You can see lots of paintings here')
- 05:37, Jun 9, 2004 Delirium deleted "Insanity" (deleting article whose only history is some redirects to prepare for a move)
- 05:36, 9 Jun 2004 Guanaco deleted "Image:Approvalballotword.gif" (orphaned, replaced with PNG)
- 04:59, 9 Jun 2004 Jiang deleted "Wallonia/temp" (no useful content; was wikicode for table)
- 04:58, 9 Jun 2004 Jiang deleted "Talk:Community Radio/temp" (content was: '#redirect [[Community Radio]]')
- 04:58, 9 Jun 2004 Jiang deleted "Community Radio/temp" (content was: '#REDIRECT [[Talk:Community_Radio/temp]]')
- 04:54, 9 Jun 2004 Chris 73 deleted "The North American Free Trade Agreement" (content was: 'uhm:]')
- 04:46, 9 Jun 2004 Jiang deleted "MediaWiki:EUc" (content was: '#redirect [[Template:EUc]]')
- 04:45, 9 Jun 2004 Jiang deleted "MediaWiki:NATOm" (content was: '#redirect [[Template:NATOm]]')
- 04:45, 9 Jun 2004 Jiang deleted "MediaWiki:Manchurian Provinces" (content was: '#redirect [[Template:Manchurian Provinces]]')
- 04:37, 9 Jun 2004 Jiang deleted "MediaWiki:PeaceLaureates" (content was: '#redirect [[Template:PeaceLaureates]]')
- 04:37, 9 Jun 2004 Guanaco deleted "Weezer (1994 album)" (page by Michael)
- 04:35, 9 Jun 2004 Jiang deleted "MediaWiki:NAM" (content was: '#redirect [[Template:NAM]]')
- 04:35, 9 Jun 2004 Guanaco deleted "Weezer (2001 album)"
- 04:31, 9 Jun 2004 Guanaco deleted "Faith, Hope, Love" (page by Michael)
- 04:28, 9 Jun 2004 Guanaco deleted "Baghdad (album)" (page by Michael)
- 04:22, 9 Jun 2004 Guanaco deleted "Somewhere Between Heaven and Hell" (page by Michael)
- 04:19, 9 Jun 2004 Maximus Rex deleted "Boavista FC" (content was: '{(Cleanup)}Home ground is Estadio do Bessa')
- 04:17, Jun 9, 2004 RickK deleted "KROQ Top 106.7 Countdown of 1991" (nonencyclopedic)
- 04:14, 9 Jun 2004 Maximus Rex deleted "US 69th Infantry Division" (content was: '[http://www.example.com link title]http://www.69th-infantry-division.com/')
- 04:09, 9 Jun 2004 Niteowlneils deleted "Marvin Perry" (content was: '{(delete)}An actor best known for his portrayal of Chandler on ''Friends''.')
- 03:58, 9 Jun 2004 Guanaco deleted "QALY" (broken redir)
- 03:57, 9 Jun 2004 Maximus Rex deleted "Blepharophimosis" (personal contact info, not an article)
- 03:50, 9 Jun 2004 Maximus Rex deleted "Conseil National de la Resistance" (content was: 'qaz')
- 03:44, 9 Jun 2004 Maximus Rex deleted "User:Maximus•Rex" (impostor)
- 03:43, 9 Jun 2004 Maximus Rex deleted "User talk:Maximus•Rex" (impostor)
- 03:42, 9 Jun 2004 Maximus Rex deleted "Left whale" (content was: '==== LEFT WHALE ====There is no such creature as a left whale,though there is one called [[right whale]].This silly but harmless but articlewas cr...')
- 03:36, 9 Jun 2004 Guanaco deleted "XY Maggazine" (created by page move of copyvio)
- 03:35, 9 Jun 2004 Wile E. Heresiarch deleted ".mpfa" (consensus to delete on vfd)
- 03:24, 9 Jun 2004 Guanaco deleted "Category:Heroic fictional scientists" (orphaned)
- 03:24, 9 Jun 2004 Guanaco deleted "Category:Oceanic Countries" (content was: '#REDIRECT [[:Category:Oceanic countries]]')
- 03:24, 9 Jun 2004 Guanaco deleted "Category:Manhattan streets" (content was: 'Please use [[:Category:Streets in Manhattan]]')
- 03:23, 9 Jun 2004 Guanaco deleted "Category:New York City streets" (content was: 'Please use [[:Category:Streets in New York City]]')
- 03:23, 9 Jun 2004 Guanaco deleted "Category:New York City transportation" (content was: 'Please use [[:Category:Transportation in New York City]]')
- 03:23, 9 Jun 2004 Guanaco restored "Category:Crop_deities"
- 03:22, 9 Jun 2004 Guanaco deleted "Category:Rebirth deities" (orphaned)
- 03:22, 9 Jun 2004 Guanaco deleted "Category:Crop deities" (orphaned)
- 03:19, 9 Jun 2004 Wile E. Heresiarch deleted "Jong Park" (consensus to delete on vfd)
- 03:02, 9 Jun 2004 Texture deleted "Terrestrial impact crater" (content was: '{(delete)}#REDIRECT [[Haughton impact crater]]')
- 02:31, 9 Jun 2004 Guanaco deleted "Wikipedia:Sandbox" (replacing sand)
- 02:21, 9 Jun 2004 Wile E. Heresiarch deleted "Dept of Botany, University of Guelph" (consensus to delete on vfd)
- 02:18, 9 Jun 2004 Guanaco deleted "Long Nines" (spam/substub)
- 02:08, 9 Jun 2004 Wile E. Heresiarch deleted "Talk:Mind-Brain Society" (talk page of deleted article)
- 02:08, 9 Jun 2004 Wile E. Heresiarch deleted "Mind-Brain Society" (consensus to delete on vfd)
- 01:54, 9 Jun 2004 Guanaco deleted "The Houses of the Molé" (page by Michael)
- 01:51, 9 Jun 2004 Guanaco deleted "Dave Jerden" (page by Michael)
- 01:50, 9 Jun 2004 Guanaco deleted "Talk:Ackley" (content was: 'made up--[[User:205.188.117.9|205.188.117.9]] 18:42, 3 May 2004 (UTC)')
- 01:50, 9 Jun 2004 Guanaco deleted "KROQ Top 106.7 Countdown of 2003" (page by Michael)
- 01:48, 9 Jun 2004 Guanaco deleted "Talk:Tyrannosaurus Hives" (content was: '{(album)}')
- 01:47, 9 Jun 2004 Guanaco deleted "Category:Crass albums" (category by Michael)
- 01:39, 9 Jun 2004 Wile E. Heresiarch deleted "Cybofree" (consensus to delete on vfd)
- 01:39, 9 Jun 2004 Guanaco deleted "Category:Elastica albums" (category by Michael)
- 01:38, 9 Jun 2004 Guanaco deleted "Primer 55" (page by Michael)
- 01:37, 9 Jun 2004 Guanaco deleted "Category:The (International) Noise Conspiracy albums" (category by Michael)
- 01:37, 9 Jun 2004 Guanaco deleted "The Lion and the Witch" (page by Michael)
- 01:30, 9 Jun 2004 Guanaco deleted "Evolver (album)" (broken redir)
- 01:29, 9 Jun 2004 Guanaco deleted "Evolver (311)" (broken double redir)
- 01:28, 9 Jun 2004 Guanaco deleted "Evolver" (page by Michael)
- 01:28, 9 Jun 2004 SimonP deleted "Executive Orders (1996)" (content was: 'This place reserved for the book review of ''[[Executive Orders]]'', as contrasted with the legal explanation in the hyperlink above.')
- 01:24, 9 Jun 2004 Guanaco deleted "User talk:64.12.116.132" (content was: '*Solid article. This makes me want to play hardball too. --[[User:205.188.116.12|205.188.116.12]] 03:35, 8 May 2004 (UTC)')
- 01:19, 9 Jun 2004 Guanaco deleted "Category:Better Than Ezra albums" (category by Michael)
- 01:15, 9 Jun 2004 Dysprosia deleted "User:Blankfaze/articlelist" (speedy'd)
- 01:13, 9 Jun 2004 Dysprosia deleted "Haha u're editing dodgy pages n00b" (content was: 'hai i made a new page')
- 01:12, 9 Jun 2004 Jrdioko deleted "Sharon Spitz" (content was: 'Braceface zip to sorry has not here boyfriend kiss lion!')
- 01:11, 9 Jun 2004 Guanaco deleted "Love Is Hell pt. 1" (page by Michael)
- 01:05, 9 Jun 2004 Dysprosia deleted "THERE IS NO GRAVITY IN WATER!!!!!!!!!" (content was: 'THERE IS NO GRAVITY IN WATER!!!!!!!!!')
- 00:47, 9 Jun 2004 Texture deleted "Mixed Up (Cure compilation)" (content was: '#REDIRECT [[Mixed Up (The Cure compilation)]]')
- 00:46, 2004 Jun 9 Ævar Arnfjörð Bjarmason deleted "Image:RUSirus.jpg" (Image is a dupe of RUSirius.jpg, deleteing upon request from uploaded)
- 00:43, 9 Jun 2004 Maximus Rex deleted "IK Dairo & the Morning Star Orchestra" (content was: '--[[User:134.39.250.6|134.39.250.6]] 00:43, 9 Jun 2004 (UTC)[[Image:Example.jpg]][[Media:Example.ogg]][http://www.example.com link title]')
- 00:38, 9 Jun 2004 Maximus Rex deleted "Dwang news" (content was: 'owned by a gay guy goto theseer.tk')
- 00:37, 9 Jun 2004 Maximus Rex deleted "Dwang news" (content was: 'dwang news is a unreliable news source.for a reliable news source (it ain't a news source though) go to [www.theseer.tk]')
- 00:35, 9 Jun 2004 Maximus Rex deleted "David wang" (content was: 'David wang has a pinny')
- 00:35, 9 Jun 2004 Maximus Rex deleted "Brown food web" (content was: 'A web of animals which eat shit.')
- 00:35, 9 Jun 2004 Guanaco deleted "X (INXS)" (broken redir by Michael)
- 00:35, 9 Jun 2004 Jiang deleted "Talk:Daniel Brandhorst" (talk of deleted)
- 00:34, 9 Jun 2004 Jiang deleted "Daniel Brandhorst" (Listed on vfd since march 22)
- 00:34, 9 Jun 2004 Guanaco deleted "Desensitized" (page by Michael)
- 00:33, 9 Jun 2004 Guanaco deleted "Eat Your Face" (page by Michael)
- 00:32, 9 Jun 2004 Dysprosia deleted "David wang" (content was: 'means pancake')
- 00:26, 9 Jun 2004 Maximus Rex deleted "A, an, at, as, am, is, are, was, were, do ,doe, did, shall, will, should, would, may, might, must, can, could" (content was: 'A, an, at, as, am, is, are, was, were, do ,doe, did, shall, will, should, would, may, might, must, can, could')
- 00:26, 9 Jun 2004 Gentgeen deleted "Category:Aiports of Kuwait" (content was: '[[Category:Airports|Kuwait]]')
- 00:25, 9 Jun 2004 Dysprosia deleted "En, Wikipedia" (content was: 'EN')
- 00:16, 9 Jun 2004 Jiang deleted "Zoran Stojkovic/Temp" (duplicated)
- 00:13, 9 Jun 2004 Jiang deleted "ȵµå°šå¿—" (listed as copyvio since 4 Feb 2004 )
- 00:12, 9 Jun 2004 Jiang deleted "Aleksandar Popovic/Temp" (duplicated)
- 00:08, 9 Jun 2004 UtherSRG deleted "Category:United States transportation" (content was: '[[Category:United States]] [[Category: Transportation]]')
- 00:07, 9 Jun 2004 UtherSRG deleted "Category:Transport" (content was: '#REDIRECT [[Category:Transportation]]')
- 00:06, 9 Jun 2004 UtherSRG deleted "Category:Ohio transportation" (content was: '[[Category:Ohio]][[Category:Transportation in the United States]]')
- 00:05, 9 Jun 2004 UtherSRG deleted "Category:Airports in Ohio" (content was: '[[Category:Ohio transportation]][[Category:Airports of the United States]]')
- 00:04, 9 Jun 2004 UtherSRG deleted "Category:New York City bridges" (content was: '[[Category:New York City transportation]][[Category:Bridges in the United States]]')
- 00:02, 9 Jun 2004 Maximus Rex deleted "Ed Schultz" (not an article)
- 23:59, 8 Jun 2004 Jrdioko deleted "Special" (content was: ':-)')
- 23:58, 8 Jun 2004 Bryan Derksen deleted "Category:Hawaiian Geography" (content was: '#REDIRECT [[:Category:Hawaiian geography]]' - fixed capitalization, no significant history)
- 23:58, 8 Jun 2004 Bryan Derksen deleted "Category:Natural Hazards" (content was: '#REDIRECT [[:Category:Natural hazards]]' - fixed capitalization, no significant history)
- 23:51, 8 Jun 2004 Camembert deleted "Peter Beard" (content was: 'n;'')
- 23:50, 8 Jun 2004 SimonP deleted "P. C. Sorcar" (content was: 'P.C Sorcar, one of the best magicians of India, was a great magician.')
- 23:43, 8 Jun 2004 Jrdioko deleted "Oberammergaueralpenkräuterdelikatessenfrühstückskäse" (content was: 'Oberammergaueralpenkräuterdelikatessenfrühstückskäse')
- 23:40, 8 Jun 2004 Guanaco deleted "Seal (1991 album)" (page by Michael)
- 23:38, 8 Jun 2004 Guanaco deleted "NCAA Men's Lacrosse Championship" (page by Michael)
- 23:33, 8 Jun 2004 Jrdioko deleted "Dicko" (content was: '{(delete)}Dicko is the name for the coolest person in the world as my name is DICKO!!! It was orginated by Charlie in 1999 for me, and I have made...')
- 23:33, 8 Jun 2004 SimonP deleted "David Hall" (content was: 'Visit http://davidhallart.com')
- 23:32, 8 Jun 2004 SimonP deleted "Bald eagle/index.html" (content was: 'bald eagles are a species of bird.')
- 23:33, 8 Jun 2004 SimonP deleted "Connally Prison" (content before blanking was: 'Connally 7 in 2001 broke of the securaty of the prison.')
- 23:30, 8 Jun 2004 Francs2000 deleted "Humlikon" (content was: 'Humlikon / Switzerlandhttp://www.humlikon.net')
- 23:30, 8 Jun 2004 Jrdioko deleted "Quipsal" (content was: 'Quipsal menas anything. It was created in 2004 by one hot young lad named dicko and his bitch charlie. charlie is by far the hotter one and has a long...')
- 23:31, 8 Jun 2004 SimonP deleted "UK Video Art: The Early Years" (content was: 'Visit http://ukvideoart.tripod.com')
- 23:19, 8 Jun 2004 Jrdioko deleted "My Birthday" (content was: 'It was the worlds best moment when I was born.')
- 23:12, 8 Jun 2004 Jrdioko deleted "Wojciech Bruszewski" (content was: 'Visit http://www.voytek.pl/aindex.htm')
- 22:53, 8 Jun 2004 Guanaco deleted "NCAA Women's Division II Basketball Championship" (page by Michael)
- 22:52, 8 Jun 2004 Guanaco deleted "NCAA Wrestling Team Championship" (page by Michael)
- 22:49, 8 Jun 2004 Guanaco deleted "Bluebonnet Bowl" (page by Michael)
- 22:49, 8 Jun 2004 Guanaco deleted "Carousel Center" (page by Michael)
- 22:42, 8 Jun 2004 Texture deleted "Muhammad Chang" (content was: 'Muhammad Chang the most common name in History, according to statiscal studies.')
- 22:37, 8 Jun 2004 Maximus Rex deleted "User talk:Mäximus Rex" (impostor)
- 22:32, 8 Jun 2004 Maximus Rex deleted "Template:Racist" (created by impostor)
- 22:30, 8 Jun 2004 Maximus Rex deleted "User:Mäximus Rex" (impostor)
- 22:27, 8 Jun 2004 Francs2000 deleted "Solarwolf" (blanked by author)
- 22:25, 8 Jun 2004 Docu deleted "List of current capital cities within the United States" (content was: )
- 22:25, 8 Jun 2004 Francs2000 deleted "Il Gesù" (content was: 'Il Gesu Vignola and DellaPorta .Rome. 1584. Baroque')
- 22:23, 8 Jun 2004 Francs2000 deleted "Phospholipids" (content was: 'http://www.eximo.no')
- 22:19, 8 Jun 2004 UtherSRG deleted "Category:Rebirth gods" (content was: '{(delete)}')
- 22:10, 8 Jun 2004 Texture deleted "Cer" (content was: 'gfgrwfwr')
- 22:10, 8 Jun 2004 Guanaco deleted "Greatest Hits '93-'03" (whole article is by Michael)
- 21:52, 8 Jun 2004 Texture restored "G-Class"
- 21:51, 8 Jun 2004 Texture deleted "G-Class" (content was: '[[Mercedes-Benz G-Class]]')
- 21:51, 8 Jun 2004 Guanaco deleted "Soundsystem (311)" (broken redir by michael)
- 21:47, 8 Jun 2004 Texture deleted "Celestial" (content was: 'Celestial : See angel')
- 21:31, 8 Jun 2004 Texture deleted "The Wealth of Nations: Book One, Chapter I" (content was: 'There has been no greater improvement in the productive powers of labor than through the appropriate combination and division of labor.')
- 21:29, 8 Jun 2004 Texture deleted "Maggotlove" (content was: 'Maggotlove is a club for all the fans of Margrethe(Nickname Maggot).Their famous slogan goes like this; MAGGOTLOVE (OR ELSE)')
- 21:28, 8 Jun 2004 Texture deleted "Zebra Lounge" (content was: 'THis movie is about some jerks that decide to screw around with swinging. These people find out the lifestyle is not for them in the end.')
- 21:27, 8 Jun 2004 Guanaco deleted "Image:'colored quartet'.pharoah's army got drowned EDIS-SRP-0198-12.mp3" (converted to OGG)
- 21:14, 8 Jun 2004 Guanaco deleted "Image:Big Bun Orch Excerpt.ogg" (listing mp3 that I converted this from for deletion)
- 21:04, 8 Jun 2004 Cyrius deleted "Booker's" (product review)
- 21:03, 8 Jun 2004 Guanaco deleted "Image:AnandSahib.mp3" (converted to OGG)
- 20:58, 8 Jun 2004 Cyrius deleted "Big muff pi" (previously VfD deleted)
- 20:53, 8 Jun 2004 Guanaco deleted "Image:1917.mp3" (converted to [[Image:1917.ogg]])
- 20:52, Jun 8, 2004 RickK deleted "Africanist" (content was: 'i need help')
- 20:47, Jun 8, 2004 RickK deleted "The Giaour" (a story)
- 20:42, 8 Jun 2004 Texture deleted "MoonRockCar" (content was: '== Just Trying This Out =='''Earth's Moon'''I don't know what a Moon Rock Car is, but I bet it's got big tires.May find info here:http://www.g...')
- 20:33, 8 Jun 2004 Texture deleted "MoonRockCar" (content was: '== Just Trying This Out =='''Earth's Moon'''I don't know what a Moon Rock Car is, but I bet it's got big tires.May find info here:http://www.g...')
- 20:02, 8 Jun 2004 Hadal deleted "Dorgem" (content was: 'http://dorgem.sourceforge.net/')
- 19:53, 8 Jun 2004 Texture deleted "Economic derivatives" (content was: '{(delete)}For detailed information on Economic Derivatives, please refer www.icapeconderivatives.com')
- 19:26, 8 Jun 2004 Maximus Rex deleted "Hand written character recognition" (an email/request not an article)
- 19:21, 8 Jun 2004 DavidWBrooks deleted "The Animatrix: Kid's Story" (content was: 'the animatrix is a big black sundial located in the middle of hong kong. neo neeeds to get there in order to eat enough cheese to wake the oracle and ...')
- 19:11, 8 Jun 2004 Meelar deleted "Porky's Duck Hunt" (content was: 'Porky's duck hunt was an abomination and is widely considered rascist and neo-nazi.')
- 19:03, 8 Jun 2004 Guanaco deleted "Template:Imagevio2" (now unneeded - use [[Template:Imagevio]])
- 19:02, 8 Jun 2004 Ahoerstemeier deleted "Great Northern Railway (Ireland)" (content was: 'pictures of the G.N.R. Train Station')
- 19:02, 8 Jun 2004 Guanaco deleted "MediaWiki:Imagevio2" (content was: '#redirect [[Template:Imagevio2]]')
- 19:00, 8 Jun 2004 Guanaco deleted "Template:Imagevio1" (content was: '#REDIRECT [[Template:Imagevio]]')
- 18:51, 8 Jun 2004 Texture deleted "Andrew B Raker" (content was: 'pengie!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!')
- 18:50, 8 Jun 2004 SimonP deleted "Agora (game)" (content was: '==Description====Rules=====Moving======Capturing======Becoming a prisoner=====Strategy=={(msg:stub)}')
- 18:50, 8 Jun 2004 Guanaco deleted "User:Guanaco/Sandbox" (content was: '{(imagevio1|url=SPAM)}')
- 18:49, 8 Jun 2004 Guanaco deleted "MediaWiki:Imagevio1" (content was: '#redirect [[Template:Imagevio1]]')
- 18:47, 8 Jun 2004 DavidWBrooks deleted "Arthur (TV)" (content was: 'Arthur is the best aardvark in Elwood. His sister, D.W. And his baby sister, Kate. Arthur was a young men since no one else gets more time than Winona...')
- 18:43, 8 Jun 2004 DavidWBrooks deleted "Trinity College Duck" (content was: 'Needs to be moved.It is currently on the top rafters of Trinity College Dining Hall. The rafter is about 35 feet above the ground. Good luck.')
- 18:42, 8 Jun 2004 Texture deleted ""Empty Spaces"" (user test)
- 18:42, 8 Jun 2004 Maximus Rex deleted "Lojas Marabras" (content was: '????')
- 18:43, 8 Jun 2004 Maximus Rex deleted "George Gipp Memorial Park" (content was: 'There is a big cock in the rectum of George Gipp at his gay cruise park.')
- 17:55, 8 Jun 2004 Ahoerstemeier deleted "History of Saskatchewan" (content was: 'saskatchewan sucksyep')
- 17:27, 8 Jun 2004 Meelar deleted "Anthony Elfeghih" (content was: 'Anthony Elfeghih is your average moron. He was born about 14 years ago and currently lives in the state of Washington. He needs to learn the differenc...')
- 17:27, 8 Jun 2004 Texture deleted "Logarithms" (content was: 'Main Entry: log•a•rithmPronunciation: 'lo-g&-'ri-[th]&m, 'lä-Function: nounEtymology: New Latin logarithmus, from log- + Greek arithmos number -...')
- 17:25, 8 Jun 2004 Meelar deleted "Surenas" (content was: 'Hello HI HI HI HI')
- 17:24, 8 Jun 2004 Texture deleted "User:Jennypei" (content was: '#REDIRECT [[User talk:Jennypei]]' - made talk page at wrong location)
- 17:19, 8 Jun 2004 Texture deleted "JFK Assassinated" (content was: '{(delete)}James was raped by John Wilkes BoothJust like eddie')
- 17:15, 8 Jun 2004 Deb deleted "Kiya Gowdie" (no useful content)
- 17:15, 8 Jun 2004 Texture deleted "Protocol analyzer" (vandalism/test)
- 16:45, 8 Jun 2004 Guanaco deleted "Image:1 track01.ogg" (I just uploaded it - the mp3 it's from appears to be a copyvio)
- 16:33, 8 Jun 2004 LouI deleted "John Burke (dissambiguation)" (clean-up after error, content was: '#REDIRECT [[John Burke (disambiguation)]]')
- 16:34, 8 Jun 2004 Hemanshu deleted "Ho-Oh" (content was: 'fuck all yao niggers out there reading this page')
- 16:12, 8 Jun 2004 Olivier deleted "De Broglie" (content was: '#REDIRECT [[Louis-Victor de Broglie]]' - preparing move page)
- 16:09, 8 Jun 2004 Texture deleted "Elephant Parts" (user test)
- 15:50, 8 Jun 2004 Texture deleted "Universiti Malaysia Sarawak" (content was: '{(delete)}i want to know the unimas email adress')
- 15:47, 8 Jun 2004 Texture deleted "User:J.P.H." (content was: '#REDIRECT [[User talk:J.P.H.]]' - created talk on wrong page)
- 15:43, 8 Jun 2004 Texture deleted "JPH" (user test)
- 15:39, 8 Jun 2004 Sverdrup deleted "Epileptiform" (content was: ''''epileptiform''' (ep'i'lep`ti`form) ''adjective.'' 1. Resembling epilepsy.Source: Websters Dictionary')
- 15:38, 8 Jun 2004 Texture deleted "C2 Cola" (content was: '{(delete)}')
- 15:28, 8 Jun 2004 Meelar deleted "Battle of)the plains of abraham" (content was: 'this page is EXTREMELY gay.')
- 15:25, 8 Jun 2004 Texture deleted "National 12 (dinghy" (content was: '#REDIRECT [[National 12 (dinghy)]]')
- 15:22, 8 Jun 2004 Hadal deleted "Talk:Johann Ambrosius Bach" (talk page of nonexistent article; content was: 'it's awesome, a real brainstorm! Leave it as Blowjob! No one else knows anything about this guy. blowjob says it all!')
- 15:22, 8 Jun 2004 Meelar deleted "66 (Unflattering) Things About Ronald Reagan" (copyvio acknowleded ''in text'', and unencyclopedic to boot)
- 15:11, 8 Jun 2004 Hajor deleted "Luís de Camões" (content was: '#REDIRECT [[Luis de Camões]]' -- delete redir for page move)
- 14:49, 8 Jun 2004 Jrdioko deleted "Real image (optics)" (content was: ''''Bold text'''[http://www.example.com link title][[Image:Example.jpg]]<nowiki>Insert non-formatted text here</nowiki>--------<nowiki>Insert non-f...')
- 14:46, Jun 8, 2004 Dori deleted "Talk:The Front Page" (content was: '[[Image:Example.jpg]][[Media:Example.ogg]]--[[User:62.139.113.115|62.139.113.115]] 10:33, 8 Jun 2004 (UTC)----'''Bold text'''''Italic text''')
- 14:45, 8 Jun 2004 Pcb21 deleted "Template:Pcb21 test" (content was: 'if this is still here in ten minutes, you can speedily delete it')
- 14:39, 8 Jun 2004 Ahoerstemeier deleted "Projects" (content was: '#REDIRECT [[User:Wgoetsch/Projects]]')
- 14:39, 8 Jun 2004 Ahoerstemeier restored "Projects"
- 14:38, 8 Jun 2004 Ahoerstemeier deleted "Projects" (content was: 'This is a list of projects that I'm working')
- 14:38, 8 Jun 2004 Ahoerstemeier deleted "The Mean Machine" (content was: '[[Image:Example.jpg]]eewty retert e rrtrdsf asdfgFuck Fuckj fuck fuck fuck fuck fuck fuck')
- 14:33, 8 Jun 2004 DavidWBrooks deleted "Purifyeps"
- 14:31, 8 Jun 2004 DavidWBrooks deleted "ScavHunt Withdrawal" (content was: 'Pronounced (<b>skav-hunt with-jrau’ol</b>) A condition, originally seen in a student in Pierce, in which University of Chicago students, in the per...')
- 14:27, Jun 8, 2004 Zanimum deleted "The Stepford Wives (2003)" (Was pure ignorance and reaction on my part, sorry. content was: '#REDIRECT [[The Stepford Wives (2004)]]')
- 14:23, 8 Jun 2004 Pcb21 deleted "Lukesmells" (content was: 'luke made love to a duck')
- 14:22, 8 Jun 2004 Ahoerstemeier deleted "Eirik" (content was: 'Eirik is a boy who lives in Norway. His classmates often say he's 'eirikterende', but all in all he's a nice guy')
- 14:20, 8 Jun 2004 Ahoerstemeier deleted "Lukesmells" (content was: 'luke tudor smells')
- 14:18, 8 Jun 2004 Ahoerstemeier deleted "Sliema" (content was: 'blah')
- 14:19, 8 Jun 2004 Ahoerstemeier deleted "Body of Myths" (content was: '[[Body of myths]]')
- 14:08, Jun 8, 2004 Zanimum deleted "Details" (content was: 'details')
- 13:48, 8 Jun 2004 Menchi deleted "Image:Zabriskie Point at sunrise in Death Valley NP-300px.JPG" (thumbnail not needed now we have advanced image auto-thumb system)
- 13:40, 8 Jun 2004 LouI deleted "Richmond (town), Sagadahoc County, Maine" (Not neded, only history was Rambot; content was: '#REDIRECT [[Richmond (town), Maine]]')
- 13:37, 8 Jun 2004 LouI deleted "Richmond (CDP), Sagadahoc County, Maine" (Not needed, only history was Rambot; content was: '#REDIRECT [[Richmond (CDP), Maine]]')
- 13:31, 8 Jun 2004 RadicalBender deleted "Woolong" (Deleting to move [[Woolongs]] to this page)
- 13:21, 8 Jun 2004 Meelar deleted "The Many Adventures of Tintin" (was deleted earlier, false information)
- 13:20, 8 Jun 2004 Francs2000 deleted "Ben Quik" (vanity)
- 13:18, 8 Jun 2004 Ahoerstemeier deleted "The Final Battle" (content was: 'I RULE!!! O yeahh '''Bold text'''''Italic text''ITS MEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE G.S. Was here and I go to lincoln everyone!')
- 13:17, 8 Jun 2004 Francs2000 deleted "Music of the Republic of the Congo" (content was: '--[[User:209.158.113.3|209.158.113.3]] 13:14, 8 Jun 2004 (UTC)== '''== '''Congo is a big country that has 10 region . the political capital of Congo...')
- 13:15, 8 Jun 2004 Francs2000 deleted "Betronic" (content was: '[[Link 888909<nowiki>Insert non-formatted text here</nowiki>[[Media:Example.ogg]]')
- 13:15, 8 Jun 2004 Francs2000 deleted "Yang Jiang" (content was: 'Yang Jiang')
- 13:14, 8 Jun 2004 Francs2000 deleted "Rosettes" (content was: 'leaves in an upset stem, arranget in a typical way.')
- 13:13, 8 Jun 2004 Francs2000 deleted "How Are We to Live?" (content was: 'Hello my name in Anthony Constantine<math>Insert formula here</math>E=mc^2')
- 12:33, 8 Jun 2004 Angela deleted "User:Practer" (was a redirect to the talk page created accidentally)
- 11:52, 8 Jun 2004 UtherSRG deleted "Foreign language" (content was: 'what is foreign language')
- 11:49, 8 Jun 2004 UtherSRG deleted "XxxMore" (page created then blanked by creator)
- 11:48, 8 Jun 2004 Charles Matthews deleted "Quasi-steady state theory" (content was: 'gay theory')
- 11:44, 8 Jun 2004 SimonP deleted "Ian Kershaw" (content was: 'Who the hell was this fucker???')
- 11:09, 8 Jun 2004 Jfdwolff deleted "Shneur Zalman of Liadi" (Make room for move from [[Shneur Zalman of Liadi]])
- 10:53, 8 Jun 2004 Jimfbleak deleted "Crackpony" (content was: 'Someone who carries crackcocane in airline smuggling.')
- 10:53, 8 Jun 2004 Jimfbleak deleted "Cracklord" (content was: 'A druglord who specializes in crack.')
- 10:52, 8 Jun 2004 Jimfbleak deleted "Eutimio Guerra" (content was: 'This person was absolutely insane')
- 10:52, 8 Jun 2004 Ahoerstemeier deleted "Modern indian history" (content was: '== '''I want to know sth about modern Indian History. Like the ones of the times of Gandhiji's time & British Rule '''')
- 10:52, 8 Jun 2004 Jimfbleak deleted "Kapil Rajgor" (content was: 'Kailashpati Mishra')
- 10:52, 8 Jun 2004 Jimfbleak deleted "Luca simonini" (content before blanking was: 'Young italian Boy, born February, 9, 1976 in Tortona (Italy).<math>2+2=0</math>--[[User:Lucacarlo|Lucacarlo]] 10:27, 8 Jun 2004 (UTC)')
- 10:50, 8 Jun 2004 Ahoerstemeier deleted "British popular culture" (content was: 'fuck')
- 10:33, Jun 8, 2004 Merovingian deleted "Image:Wp sweetpea closeup small.jpeg" (speedy delete candidate')
- 10:15, 8 Jun 2004 Viajero deleted "Image:MirellaFreni.jpg" (already uploaded it)
- 09:47, 8 Jun 2004 Guanaco deleted "Image:W,74-thumb.jpg" (listed on IFD since May 23)
- 09:48, 8 Jun 2004 Guanaco deleted "Image:Tm,69-thumb.jpg" (listed on IFD since May 23)
- 09:47, 8 Jun 2004 Guanaco deleted "Image:Tl,81-thumb.jpg" (listed on IFD since May 23)
- 09:47, 8 Jun 2004 Guanaco deleted "Image:Tb,65-thumb.jpg" (listed on IFD since May 23)
- 09:48, 8 Jun 2004 Guanaco deleted "Image:Ta,73-thumb.jpg" (listed on IFD since May 23)
- 09:47, 8 Jun 2004 Guanaco deleted "Image:Sr,38-thumb.jpg" (listed on IFD since May 23)
- 09:47, 8 Jun 2004 Guanaco deleted "Image:Sn,50-thumb.jpg" (listed on IFD since May 23)
- 09:47, 8 Jun 2004 Guanaco deleted "Image:Sb,51-thumb.jpg" (listed on IFD since May 23)
- 09:46, 8 Jun 2004 Guanaco deleted "Image:Rh,45-thumb.jpg" (listed on IFD since May 23)
- 09:47, 8 Jun 2004 Guanaco deleted "Image:Pt,78-thumb.jpg" (listed on IFD since May 23)
- 09:46, 8 Jun 2004 Guanaco deleted "Image:Pr,59-thumb.jpg" (listed on IFD since May 23)
- 09:46, 8 Jun 2004 Guanaco deleted "Image:Pd,46-thumb.jpg" (listed on IFD since May 23)
- 09:47, 8 Jun 2004 Guanaco deleted "Image:Pb,82-thumb.jpg" (listed on IFD since May 23)
- 09:46, 8 Jun 2004 Guanaco deleted "Image:Nd,60-thumb.jpg" (listed on IFD since May 23)
- 09:47, 8 Jun 2004 Guanaco deleted "Image:Os,76-thumb.jpg" (listed on IFD since May 23)
- 09:45, 8 Jun 2004 Guanaco deleted "Image:Nb,41-thumb.jpg" (listed on IFD since May 23)
- 09:44, 8 Jun 2004 Guanaco deleted "Image:Yb,70-thumb.jpg" (listed on IFD since May 23)
- 09:44, 8 Jun 2004 Guanaco deleted "Image:Zr,40-thumb.jpg" (listed on IFD since May 23)
- 09:45, 8 Jun 2004 Guanaco deleted "Image:Me IEEE bw2.jpg" (listed on IFD since May 23)
- 09:45, 8 Jun 2004 Guanaco deleted "Image:Image2462.jpg" (listed on IFD since May 23)
- 09:44, 8 Jun 2004 Guanaco deleted "Image:MrT.jpg" (listed on IFD since May 23)
- 09:45, 8 Jun 2004 Guanaco deleted "Image:Y,39-thumb.jpg" (listed on IFD since May 23)
- 09:44, 8 Jun 2004 Guanaco deleted "Image:Xe,54-thumb.jpg" (listed on IFD since May 23)
- 09:43, 8 Jun 2004 Guanaco deleted "Image:La,57-thumb.jpg" (listed on IFD since May 23)
- 09:43, 8 Jun 2004 Guanaco deleted "Image:Mo,42-thumb.jpg" (listed on IFD since May 23)
- 09:42, 8 Jun 2004 Angela deleted "Celephaïs" (content before blanking was a broken redirect)
- 09:43, 8 Jun 2004 Guanaco deleted "Image:I,53-thumb.jpg" (listed on IFD since May 23)
- 09:43, 8 Jun 2004 Guanaco deleted "Image:Ho,67-thumb.jpg" (listed on IFD since May 23)
- 09:43, 8 Jun 2004 Guanaco deleted "Image:Hg,80-thumb.jpg" (listed on IFD since May 23)
- 09:43, 8 Jun 2004 Guanaco deleted "Image:Hf,72-thumb.jpg" (listed on IFD since May 23)
- 09:43, 8 Jun 2004 Angela deleted "The Silver Key" (was a broken redirect before blanking)
- 09:43, 8 Jun 2004 Guanaco deleted "Image:Gd,64-thumb.jpg" (listed on IFD since May 23)
- 09:41, 8 Jun 2004 Guanaco deleted "Image:F,9-thumb.jpg" (listed on IFD since May 23)
- 09:42, 8 Jun 2004 Guanaco deleted "Image:Er,68-thumb.jpg" (listed on IFD since May 23)
- 09:42, 8 Jun 2004 Guanaco deleted "Image:Dy,66-thumb.jpg" (listed on IFD since May 23)
- 09:41, 8 Jun 2004 Guanaco deleted "Image:Ce,58-thumb.jpg" (listed on IFD since May 23)
- 09:42, 8 Jun 2004 Guanaco deleted "Image:Cd,48-thumb.jpg" (listed on IFD since May 23)
- 09:41, 8 Jun 2004 Guanaco deleted "Image:Bi,83-thumb.jpg" (listed on IFD since May 23)
- 09:42, 8 Jun 2004 Guanaco deleted "Image:Ba,56-thumb.jpg" (listed on IFD since May 23)
- 09:41, 8 Jun 2004 Guanaco deleted "Image:Au,79-thumb.jpg" (listed on IFD since May 23)
- 09:40, 8 Jun 2004 Guanaco deleted "Image:Ag,47-thumb.jpg" (listed on IFD since May 23)
- 09:40, 8 Jun 2004 Guanaco deleted "Image:Me 262-thumb.jpg" (listed on IFD since May 23)
- 09:41, 8 Jun 2004 Guanaco deleted "Image:LunariaRediviva-thumb.jpg" (listed on IFD since May 23)
- 09:39, 8 Jun 2004 Guanaco deleted "Image:Angus cattle thumbanil.jpg" (listed on IFD since May 23)
- 09:39, 8 Jun 2004 Guanaco deleted "Image:Horse-thumbnail.jpg" (listed on IFD since May 23)
- 09:39, 8 Jun 2004 Guanaco deleted "Image:Chinese redbud cultivar thumbnail.jpg" (listed on IFD since May 23)
- 09:40, 8 Jun 2004 Guanaco deleted "Image:Clarinet-thumbnail.jpg" (listed on IFD since May 23)
- 09:39, 8 Jun 2004 Guanaco deleted "Image:Clupeiformis-thumbnail.jpg" (listed on IFD since May 23)
- 09:40, 8 Jun 2004 Guanaco deleted "Image:Chipmunk-thumbnail.jpg" (listed on IFD since May 23)
- 09:38, 8 Jun 2004 Guanaco deleted "Image:Concrete lawn thumb.jpg" (listed on IFD since May 23)
- 09:32, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 25 thumbnail.jpg"
- 09:32, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 24 thumbnail.jpg"
- 09:31, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 23 thumbnail.jpg"
- 09:31, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 21 thumbnail.jpg"
- 09:32, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 22 thumbnail.jpg"
- 09:31, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 20 thumbnail.jpg"
- 09:32, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 19 thumbnail.jpg"
- 09:31, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 18 thumbnail.jpg"
- 09:31, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 17 thumbnail.jpg"
- 09:31, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 16 thumbnail.jpg"
- 09:30, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 15 thumbnail.jpg"
- 09:30, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 14 thumbnail.jpg"
- 09:31, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 13 thumbnail.jpg"
- 09:30, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 12 thumbnail.jpg"
- 09:31, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 11 thumbnail.jpg"
- 09:29, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 9 thumbnail.jpg"
- 09:29, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 8 thumbnail.jpg"
- 09:30, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 7 thumbnail.jpg"
- 09:30, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 6 thumbnail.jpg"
- 09:29, 8 Jun 2004 Angela deleted "Selected anniversaries/June" (content before blanking was: 'asdasdasd')
- 09:29, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 5 thumbnail.jpg"
- 09:28, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 4 thumbnail.jpg"
- 09:29, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 3 thumbnail.jpg"
- 09:28, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 2 thumbnail.jpg"
- 09:29, 8 Jun 2004 Guanaco deleted "Image:Angus cattle 1 thumbnail.jpg" (all Angus cattle thumbs listed on IFD since May 23)
- 09:27, 8 Jun 2004 Guanaco deleted "Image:Apple pie thumbnail.jpg" (listed on IFD since May 23)
- 09:26, 8 Jun 2004 Maximus Rex deleted "Antigen presenting cell" (content was: ''''Bold text'''''Italic text''[[Link title]]')
- 09:26, 8 Jun 2004 Guanaco deleted "Image:Apple QuickTime Player 6.4 playing The Polar Express trailer thumbnail.jpg" (listed on IFD since May 23)
- 09:25, 8 Jun 2004 Guanaco deleted "Image:Apple iMovie 2.1.2 screenshot thumbnail.png" (listed on IFD since May 23)
- 09:24, 8 Jun 2004 Guanaco deleted "Image:Apple Sherlock 3.5.2 (v3.5.2:1.0.2) Movies channel screenshot thumbnail.jpg" (listed on IFD since May 23)
- 09:24, 8 Jun 2004 Tom- deleted "Monobook.css" (CSS file in main namespace)
- 09:24, 8 Jun 2004 Guanaco deleted "Image:Berries thumbnail.jpg" (listed on IFD since May 23)
- 09:23, 8 Jun 2004 Guanaco deleted "Image:Beaver-thumbnail.jpg" (listed on IFD since May 23)
- 09:20, 8 Jun 2004 Angela deleted "Armi Kuusela" (content was: 'Test')
- 09:13, 8 Jun 2004 Guanaco deleted "Image:Clematis hybrid thumbnail.jpg" (listed on IFD since May 23)
- 09:12, 8 Jun 2004 Guanaco deleted "Image:ClematisMarmoraria-thumb.jpg" (listed on IFD since May 23)
- 08:33, 8 Jun 2004 Maximus Rex deleted "Talk:Flesch-Kincaid Reading Level" (copyrighted, off topic text (no other history))
- 07:56, 8 Jun 2004 Niteowlneils deleted "Prime Meridian" (content was: '#REDIRECT [[Prime meridian]]')
- 07:55, Jun 8, 2004 Jmabel deleted "William Forgan Smith" (content was: '{(msg:delete)}William Forgan Smith was my Great Great Uncle, how my family ended p back in the UK is still a sad mystery, shame really, I love Austr...')
- 07:53, 8 Jun 2004 Maximus Rex deleted "Marlowe Fermin Revilla" (nonsense)
- 07:51, Jun 8, 2004 Jmabel deleted "Letter to a child never born" (Appears to be an original work of imaginative fiction, in Spanish, with no particularly obvious relation to the [[Oriana Fallaci]] story whose name is the only link to this page.)
- 07:02, Jun 8, 2004 Raul654 deleted "Image:Foreverwar.jpg" (already exists)
- 06:50, 8 Jun 2004 Bryan Derksen deleted "Rial" (content was: '#REDIRECT [[Iranian_Rial]]' - no history, making way for a move)
- 06:46, Jun 8, 2004 RickK deleted "Stairway to the Moon" (content was: '{(msg:delete)}[[Image:[[Media:<math><nowiki>--Guanaco 06:28, 10 Jun 2004 (UTC)'''''amy rox!'''''</nowiki></math>]]]] ==]]]'''''')
- 06:43, Jun 8, 2004 RickK deleted "Step growth" (content was: '== Headline text ==the')
- 06:40, Jun 8, 2004 Sarge Baldy deleted "Governor of Oregon" (content was: '#redirect [[List_of_Governors of Oregon]]')
- 06:05, 8 Jun 2004 Bryan Derksen deleted "Category:Civil Wars" (content was: '#REDIRECT [[:Category:Civil wars]]' - moved over to lower case)
- 05:47, 8 Jun 2004 Meelar deleted "Nobunaga's Ambition - Lords of Darkness" (content was: 'So many details in this game to keep track of. This is a relly intese and hard game though i loved it. If you can get one go for it.')
- 05:09, Jun 8, 2004 TUF-KAT restored "List_of_hip_hop_musicians"
- 05:08, Jun 8, 2004 TUF-KAT deleted "List of hip hop musicians" (making way for a move)
- 04:49, 8 Jun 2004 Chris 73 deleted "Paraguay Air Force" (content was: '--[[User:200.175.137.5|200.175.137.5]] 04:41, 8 Jun 2004 (UTC)<math>Insert formula here</math>[[Media:Example.ogg]]--[[User:200.175.137.5|200.175.137....')
- 04:48, Jun 8, 2004 Flockmeal deleted "Ahman Green" (content was: '{(delete)}green bay packers running back #34. he tends to fumble the ball a lot when wearing a sleve, costing the packers a drive sometimes. altho...')
- 04:45, Jun 8, 2004 Flockmeal deleted "Culture of Tonga" (content was: 'tonga')
- 04:22, 8 Jun 2004 Chris 73 deleted "Nurse Duckett" (content was: 'Nurse Duckett is Yossarian's lover.')
- 04:22, 8 Jun 2004 Chris 73 deleted "Casting drama"
- 04:22, 8 Jun 2004 UtherSRG deleted "Category:Sports Trophies and Awards" (content was: '#REDIRECT [[:Category:Sports trophies and awards]]')
- 04:17, 8 Jun 2004 Infrogmation deleted "Mandibula" (orhan sub-stub defintion attempt; content was: 'The lower jawbone of vertebrates.')
- 04:16, 8 Jun 2004 Infrogmation deleted "Imogen Heap" (orphan sub-stub; content was: 'Female singer. Member of the band Frou Frou.')
- 04:14, 8 Jun 2004 Infrogmation deleted "MarloweRevilla" (content was: '{(Marlowe Fermin Revilla)}== Marlowe Fermin Revilla (1984-)==<br><br>')
- 03:51, 8 Jun 2004 Cyrius deleted "User talk:RïckK" (imposter page)
- 03:51, 8 Jun 2004 Cyrius deleted "User:RïckK" (imposter's page.)
- 03:49, 8 Jun 2004 Michael Snow deleted "User talk:Michael Snow/Archive {Apr-May 2004)" (my own subpage, incorrectly named)
- 03:47, 8 Jun 2004 Isomorphic deleted "Tokipona:" (bizarre nonsense)
- 03:45, 8 Jun 2004 Maximus Rex deleted "The Final Battle" (content was: '{(msg:delete)}LALALA LAND!')
- 03:33, 8 Jun 2004 Nunh-huh deleted "Barbara Simpson" (content was: '#REDIRECT [[Bart Simpson]]' vandalism)
- 03:25, 8 Jun 2004 Nunh-huh deleted "Barbara Simpson" (vandalism. content was: '#REDIRECT [[Barbara Bush]]', who was never named Barbara Simpson)
- 03:05, 8 Jun 2004 Jiang deleted "William Perry" (content was: '#REDIRECT [[William Perry (football)]]')
- 02:59, Jun 8, 2004 Silsor deleted "Solange Lecarrio" (this was already deleted as a copyvio in January, now recreated with same content)
- 15:56, 6 Jun 2004 Guanaco deleted "Pinkusoli-ETV News" (content was: 'He is Sports Journalist. He did his scholling in Vidhya Bharati`s school-Saraswati Vidhya Mandir at Agra.Contact Address57, Rakesh Niketan, Balaj...')
- 15:45, 6 Jun 2004 Guanaco deleted "MS-DOS Executive" (content was: '== Headline text ==STAMOS'''Bold text'''STAMOS----'''Bold text'''PROGRAMS[A:/PROG/QB/QBASIC link title]----<math>Insert formula here</math>...')
- 15:32, 6 Jun 2004 Guanaco deleted "Plastic laminate" (content was: 'i smell!')
- 14:59, 6 Jun 2004 Charles Matthews deleted "Pinkusoli" (content was: '[[http://en.wikipedia.org/wiki/User:Pinkusoli]]')
- 14:31, 6 Jun 2004 Chris 73 deleted "System Design Life Cycle" (content before blanking was: 'bfdhzgfs ythryt gfshgfu hgtus 6tytfu jyytikyt tr thtrw gtryty, fbwfgliri fd wjklrq whril3ur ewu2opq4hgb4 feklrebtnj4toipy tjj breqt eqpqt5uiop ds...')
- 14:28, 6 Jun 2004 Chris 73 deleted "Stuart Diver" (content was: '{(delete)}howddy neighbour hows life going well sturat diver is a ..... hmmm bitch i rekon his such a meanie I HATE HIM SOOOOO MUCH. don't haunt m...')
- 14:15, 6 Jun 2004 Sverdrup deleted "Chocha" (listed on vfd; delete.)
- 14:13, 6 Jun 2004 Sverdrup deleted "MediaWiki:VfD-Chocha" (useless redir; content was: '#redirect [[Template:VfD-Chocha]]')
- 14:11, 6 Jun 2004 Sverdrup deleted "Template:VfD-ListofPuertoRicanphraseswordsandslangs" (discussion moved to talk)
- 14:11, 6 Jun 2004 Sverdrup deleted "MediaWiki:VfD-ListofPuertoRicanphraseswordsandslangs" (content was: '#redirect [[Template:VfD-ListofPuertoRicanphraseswordsandslangs]]')
- 14:01, 6 Jun 2004 Sverdrup deleted "Husayn Kamil" (content was: 'This was a great man,')
- 13:46, 6 Jun 2004 Stan Shebs deleted "Michael Bushnell" (content before blanking was: 'je to pako')
- 13:32, 6 Jun 2004 Menchi deleted "Image:Bush Dalai Lama small.jpg" (thumbnail not needed now we have advanced image auto-thumb system)
- 13:30, 6 Jun 2004 Dysprosia deleted "Category:Computer software" (content already at - [[Category:Software]], orphaned properly, content was: '[[Category:Computation]][[Category:Computers]]')
- 13:25, 6 Jun 2004 Dysprosia deleted "Category:Operating system" (this is at operating systems - content was: '[[Operating system]][[Category:System software]]')
- 13:08, 6 Jun 2004 Dysprosia deleted "Category:Unix-Like" (making new with proper title - content was: '[[Unix-like]][[Category:Computer software]]')
- 12:18, 6 Jun 2004 Jimfbleak deleted "Dish lickers" (dic def content was: '{(stub)}Dish lickers is an [[Australian]] slang term for [[greyhound racing]].')
- 12:09, 6 Jun 2004 Sverdrup deleted "Direct Marketing" (content was: '[[junk mail]]')
- 12:08, 6 Jun 2004 Sverdrup deleted "The National Trust (TV series)" (content was: 'hi')
- 11:51, 6 Jun 2004 Charles Matthews deleted "Nothing at all" (content was: '[http://demo.editme.com EditMe Demo Page]')
- 11:27, 6 Jun 2004 Dysprosia deleted "Category:OPENSTEP" (- using Cat:NeXT instead)
- 11:08, Jun 6, 2004 Cimon avaro deleted "Pamela Hicks" (content was: 'Pamela Hicks is a female born in Aylmer Quebec whose life consists of being a cheap lay, alcoholic, and general bad person.')
- 11:00, 6 Jun 2004 Dysprosia deleted "Hell yes. ~ Nurie" (content before blanking was: 'Nurie is a little button. We luff her. ...She luffs Wonderboy, who is also a little button.She is the Queen Of All-Nighters.')
- 10:51, 6 Jun 2004 Sverdrup deleted "OMFG HOT ~Arws" (content was: '{(delete)}Arwen is the mother of Agent Smith's child. Her name is Angel Smith.We love her lots. She is siter to Nurie.')
- 10:35, 6 Jun 2004 Jfdwolff deleted "Jacob ben Asher" (content was: '#REDIRECT [[Baal ha-Turim]]' make room for move from Baal ha-Turim)
- 10:05, 6 Jun 2004 Tom- deleted "User:Himself." (I accidentally edited user page, removed)
- 08:14, 6 Jun 2004 Maximus Rex deleted "Transwiki:Zazaki" (already have a page on [[Zazaki]])
- 07:12, 6 Jun 2004 Dysprosia deleted "Category:Calculation" (moved to Cat:Computation - content was: '[[Category:Mathematics]][[Category:Computer science]]A '''[[calculation]]''' is a deliberate process for transforming one or more inputs into one or...')
- 07:02, 6 Jun 2004 Dysprosia deleted "Category:Mathematical software" (merged with Cat:Calculation - content was: '[[Category:Software]][[Category:Calculation]]')
- 06:57, 6 Jun 2004 Dysprosia deleted "Category:Calculating devices" (merged into another cat: content was: '[[Category:Computer science]][[Category:Mathematics]]')
- 06:45, 6 Jun 2004 Chris 73 deleted "Montesinos, Vladimiro"
- 06:45, 6 Jun 2004 Chris 73 deleted "Labyrinthodontia" (content was: '[[Image:Example.jpg]]')
- 06:41, 6 Jun 2004 Meelar deleted "Image:NSA headquarters.jpg" (I'll figure this out, I swear)
- 06:41, 6 Jun 2004 Menchi deleted "Image:DahliaDahlstarSunsetPink-thumb.jpg" (defunct thumb due to new syntax)
- 06:40, 6 Jun 2004 Menchi deleted "Image:DahliaMoonfire-thumb.jpg" (defunct thumb due to new syntax)
- 06:40, 6 Jun 2004 Menchi deleted "Image:DahliaLlandaff-thumb.jpg" (defunct thumb due to new syntax)
- 06:39, 6 Jun 2004 Meelar deleted "Image:Image00006.jpg" (alt version coming)
- 06:34, Jun 6, 2004 Merovingian deleted "Don Michael Randel" (content was: '{(delete)}')
- 06:30, 6 Jun 2004 Maximus Rex deleted "Klingdork" (spam)
- 06:29, 6 Jun 2004 Maximus Rex deleted "Klingdork" (spam)
- 06:21, Jun 6, 2004 Merovingian deleted "Freshball" ({(delete)})
- 06:21, Jun 6, 2004 Merovingian deleted "TABnet" (consensus to delete)
- 05:53, 6 Jun 2004 Jimfbleak deleted "IRLP" (link to non-existent page: content was: '# REDIRECT[[Internet Radio Linking Project]]')
- 05:37, 6 Jun 2004 Meelar deleted "Mario vs. Donkey Kong" (content was: 'A new game arrives all more ways they do.')
- 05:28, 6 Jun 2004 Maximus Rex deleted "Armadillo lizard" (content was: ' Armadillo Lizards are related to sirens and mudpuppys')
- 05:04, 6 Jun 2004 Jrdioko deleted "Trick lock" (content was: '[[Media:Example.ogg]]gdlkgjdlgkjdflgjkldlfkgjdljk')
- 04:26, 6 Jun 2004 Infrogmation deleted "Doi Moi" (content was: 'KHVFFVGFHYJHBJHVHCHBJHVHKBM')
- 04:25, 6 Jun 2004 Infrogmation deleted "Sterling peoples" (content was: 'Just a guy, really.Websitewww.sterlingpeoples.com')
- 04:25, 6 Jun 2004 Infrogmation deleted "Michael E. Knight" (content was: 'Actor Michael E. Knight plays Tad Martin on All My Children.')
- 04:25, 6 Jun 2004 Infrogmation deleted "Judy Cassab" (content was: '== Headline text ==I GOT A HUNGERAND I CAN'T SEEM TO GET FULL')
- 04:24, 6 Jun 2004 Cyrius deleted "Template:VfD-1 3 4 5 6 decillion etc" (never used VfD Template page)
- 04:24, 6 Jun 2004 Infrogmation deleted "System Design Life Cycle" (abandoned stub attempt blanked by original/only contributor; content before blanking was: 'System Development Life Cycle6 Phases1. Preliminary Investigation2. Systems Analysis3. Systems Design4. Systems Developement5. Systems Im...')
- 04:24, 6 Jun 2004 Cyrius deleted "MediaWiki:VfD-1 3 4 5 6 decillion etc" (unneeded VfD redirect)
- 04:23, 6 Jun 2004 Infrogmation deleted "Robin Mattson" (content was: 'Actress Robin Mattson stars in soaps such as General Hospital and AllMy Children.')
- 04:20, 6 Jun 2004 Infrogmation deleted "Eldest" (content was: 'Blah,blah,blah,blah,blah,blah,blah,bl-YOu get the idea!')
- 03:25, 6 Jun 2004 Wile E. Heresiarch restored "Pascal's_Triangle"
- 03:23, 6 Jun 2004 Wile E. Heresiarch deleted "Pascal's triangle" (delete this redirect in preparation for moving [[Pascals Triangle]] to this location)
- 03:18, 6 Jun 2004 Wile E. Heresiarch deleted "Pascal's Triangle" (deletion of redirect in preparation for moving [[Pascals triangle]] (no apostrophe) to [[Pascal's triangle]]; [[Pascals triangle]] has all the material, should be the other way around)
- 03:13, 6 Jun 2004 Guanaco deleted "Vendémiaire" (content was: '<marquee>KRiSTiNA R0X</marquee>')
- 03:03, 6 Jun 2004 Maximus Rex deleted "Qytezë" (content was: 'AHHHHHHHHHHHHHHH!!!!')
- 02:50, 6 Jun 2004 Guanaco deleted "Talk:Tretrigintillion" (content was: 'This page is important, it is connected to googol.')
- 02:49, 6 Jun 2004 Guanaco deleted "Talk:Duotrigintillion" (content was: 'This page is important, it is connected to googol.')
- 02:46, 6 Jun 2004 Guanaco deleted "Talk:Septendecillion" (content was: 'This page is important, it is connected to googol.')
- 02:46, 6 Jun 2004 Guanaco deleted "Talk:Sexdecilliard" (content was: 'This page is important, it is connected with Googol.')
- 02:44, 6 Jun 2004 Guanaco deleted "Talk:Battleground state" (content was: 'See [[Talk:Swing state]]')
- 02:44, 6 Jun 2004 Guanaco deleted "Slums Attack" (content was: 'typowe ziomy z Poznania')
- 02:42, 6 Jun 2004 Maximus Rex deleted "Rosy Bindi" (content was: 'Politician, she has became famous mostly for her extraordinary uglyness during her short tenure as Minister of Health Care. A right-winged politician,...')
- 02:28, 6 Jun 2004 Infrogmation deleted "Mandibula" (orphan sub-stub; content was: 'The lower jawbone in [[vertebrates]].')
- 02:25, 6 Jun 2004 Wile E. Heresiarch deleted "Template:List of programming languages" (votes 7 delete, 2 keep & some neutral in vfd discussion)
- 02:03, 6 Jun 2004 Guanaco deleted "Talk:Pi" (clearing redirect for page move)
- 02:02, 6 Jun 2004 Guanaco deleted "Talk:π" (clearing redir for page move)
- 02:01, 6 Jun 2004 Guanaco deleted "Pi" (clearing redir for page move)
- 01:46, 6 Jun 2004 Cyrius deleted "Bank Street, Wollongong" (VfD - consensus to delete)
- 01:45, Jun 6, 2004 Merovingian deleted "-- April" (redirect across namespaces)
- 01:34, Jun 6, 2004 Dori deleted "List of people who died without tortoises on their heads" (content was: 'hitlereinsteingeorge washingtnojohn lennon')
- 01:31, 6 Jun 2004 Finlay McWalter deleted "Devon Routier" (content was: '{(delete)}' (preceeded only by profanity))
- 01:30, 6 Jun 2004 Cyrius deleted "Template:VfD-MENS" (unneeded VfD redirect)
- 01:30, 6 Jun 2004 Cyrius deleted "MediaWiki:VfD-MENS" (unneeded VfD redirect)
- 01:28, 6 Jun 2004 Cyrius deleted "Template:VfD-TENS" (unneeded VfD redirect)
- 01:27, 6 Jun 2004 Cyrius deleted "MediaWiki:VfD-TENS" (unneeded VfD redirect)
- 01:26, 6 Jun 2004 Cyrius deleted "Rene Gonzalez" (VfD - consensus to delete)
- 01:24, 6 Jun 2004 Cyrius deleted "Rhyanne" (VfD - consensus to delete)
- 01:14, 6 Jun 2004 Cyrius deleted "Pouffe" (VfD - personal judgement of opinions.)
- 00:56, 6 Jun 2004 Cyrius deleted "OnLine Gamers Anonymous" (VfD - consensus to delete)
- 00:55, 6 Jun 2004 Cyrius deleted "Tan-Hauser Gate" (VfD - consensus to delete)
- 00:54, 6 Jun 2004 Cyrius deleted "David Elms" (VfD - consensus to delete)
- 00:52, 6 Jun 2004 Cyrius deleted "Egalocracy" (VfD - consensus to delete)
- 00:52, 6 Jun 2004 Cyrius deleted "Keith C. McCormic" (VfD - consensus to delete)
- 00:50, 6 Jun 2004 Cyrius deleted "The Many Adventures of Tintin" (VfD - consensus to delete)
- 00:50, 6 Jun 2004 Cyrius deleted "Tiny Toon Adventures: The Baby-Sitters Club" (VfD - consensus to delete)
- 00:50, 6 Jun 2004 Cyrius deleted "Image:Flag of solar system.png" (image associated with VfD deleted article - no future use)
- 00:49, 6 Jun 2004 Cyrius deleted "Flag of Solar System" (VfD - consensus to delete)
- 00:47, 6 Jun 2004 Cyrius deleted "Long Future" (VfD - consensus to delete)
- 00:46, 6 Jun 2004 Cyrius deleted "Lynsey De Paul and Mike Moran" (VfD - consensus to delete)
- 00:45, 6 Jun 2004 Cyrius deleted "Jimmy Tseng" (VfD - consensus to delete)
- 00:45, 6 Jun 2004 Cyrius deleted "Car Crashing Channel" (VfD - consensus to delete)
- 00:43, 6 Jun 2004 Cyrius deleted "Where the Magic Begins" (VfD - consensus to delete)
- 00:43, 6 Jun 2004 Chris 73 deleted "John Hennigan" (content was: 'John Hennigan is the Tough Enough 2 Champion. The show tough enough was hosted by Al Snow{(msg:delete)}')
- 00:41, 6 Jun 2004 Cyrius deleted "Bhak Jonghwa" (VfD - consensus to delete)
- 00:31, 6 Jun 2004 Guanaco deleted "Category:Rush albums" (michael)
- 00:31, 6 Jun 2004 Guanaco restored "Category:Rush_albums"
- 00:30, 6 Jun 2004 Guanaco deleted "Category:Rush albums" (michael)
- 00:25, 6 Jun 2004 Maximus Rex deleted "Hostile Makeover" (nonsense)
- 00:08, 6 Jun 2004 Francs2000 deleted "Categories:Differential equations" (speedy del for 2nd time today: category should be singular, not plural)
- 00:04, 6 Jun 2004 Maximus Rex deleted "Title=User talk:Llywrch" (wrong place for talk)
- 00:01, Jun 6, 2004 Minesweeper deleted "Merrill Lynch" (clear redirect for move; content was: '#REDIRECT [[Merrill Lynch & Co., Inc.]]')
- 23:57, 5 Jun 2004 Francs2000 deleted "Jeff edmundson" (content before blanking was: 'This is a teacher.')
- 23:54, 5 Jun 2004 Francs2000 deleted "Selene Walters" (content was: 'Reagan Never should have been anything more than Leader of the screen Actors Guild, surely not the free world!')
- 23:53, 5 Jun 2004 Infrogmation deleted "Arthur (TV)" (content was: 'The television animated series '''''Arthur''''' aired on the [[PBS Kids]] line-up.')
- 23:50, 5 Jun 2004 Infrogmation deleted "Tommy Davidson" (unhelpful sub stub (duplicates minimal info in what links here): content was: '{(msg:cleanup)}Actor Tommy Davidson stars in shows such as In Living Color and TheProud Family.')
- 23:42, 5 Jun 2004 Infrogmation deleted "Flexure" (unhelpful sub-stub; content was: 'Flexure lives in Houston and is one of the Supreme Forces in the Universe.')
- 23:42, 5 Jun 2004 Infrogmation deleted "Power Rangers: SPD" (unhelpful sub-stub; content was: 'next year power rangers show')
- 23:36, 5 Jun 2004 Maximus Rex deleted "Heroes Day" (content was: 'A day where the best are worshipped.')
- 23:35, 5 Jun 2004 Maximus Rex deleted "Absurdity" (content was: 'Absurdity is a form of humour which eats penis')
- 23:33, 5 Jun 2004 Ahoerstemeier deleted "Ahold" (content was: 'Ahold sucks, 'nuff said.')
- 23:29, 5 Jun 2004 Guanaco deleted "Megaloceros giganteus" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:29, 5 Jun 2004 Guanaco deleted "People's Democratic Republic of Yemen" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:29, 5 Jun 2004 Guanaco deleted "Jupiter IRBM" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:28, 5 Jun 2004 Guanaco deleted "Castellina in Chianti" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:28, 5 Jun 2004 Guanaco deleted "NaS battery" (redir to deleted copyvio)
- 23:28, 5 Jun 2004 Guanaco deleted "NAS battery" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:27, 5 Jun 2004 Guanaco deleted "Fieseler Fi 98" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:27, 5 Jun 2004 Guanaco deleted "Arado Ar 197" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:27, 5 Jun 2004 Guanaco deleted "Arado Ar 76" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:26, 5 Jun 2004 Guanaco deleted "Arado Ar 66" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:26, 5 Jun 2004 Guanaco deleted "I-kuan Tao" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:25, 5 Jun 2004 Guanaco deleted "Vindemiatrix" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:25, 5 Jun 2004 UtherSRG deleted "VF-713" (good information, wrong article)
- 23:24, 5 Jun 2004 Guanaco deleted "PT-13 Kaydet" (redir to deleted copyvio)
- 23:24, 5 Jun 2004 Guanaco deleted "PT-17 Kaydet" (redir to deleted copyvio)
- 23:22, 5 Jun 2004 Guanaco deleted "Image:Robert bunda addresses legislature.jpg" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:21, 5 Jun 2004 Guanaco deleted "Yakovlev Yak-18" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:21, 5 Jun 2004 Guanaco deleted "Yakovlev Yak-11" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:21, 5 Jun 2004 Guanaco deleted "Cornelius Van Til" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:21, 5 Jun 2004 Guanaco deleted "Stearman" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:20, 5 Jun 2004 Guanaco deleted "Tupolev Tu-22M" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:21, 5 Jun 2004 Guanaco deleted "Ancient Order of Frothblowers" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:19, 5 Jun 2004 Guanaco deleted "Titan II" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:19, 5 Jun 2004 Guanaco deleted "Federal Funds Rate" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:18, 5 Jun 2004 Nunh-huh deleted "Lester B. Penis" (content was: 'a dick head')
- 23:19, 5 Jun 2004 Guanaco deleted "Massage Therapy School - NMSNT" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:18, 5 Jun 2004 Guanaco deleted "Bass Pro Shops" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:19, 5 Jun 2004 Guanaco deleted "Bioconjugate" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:18, 5 Jun 2004 Guanaco deleted "Andre Thi Truong" (listed as copyvio for more than 7 days; no objection to deletion)
- 23:09, 5 Jun 2004 Maximus Rex deleted "User talk:RìckK" (content was: 'Call me RickK.')
- 23:08, 5 Jun 2004 Maximus Rex deleted "User:RìckK" (content was: 'Hello, i'm RickK')
- 22:53, 5 Jun 2004 Jfdwolff deleted "MedicinE" (content was: '#REDIRECT [[Medicine]]' - nonsensical redirect)
- 22:38, 5 Jun 2004 Guanaco deleted "Talk:Kajagoogoo" (content before blanking was: 'i there crap')
- 22:38, 5 Jun 2004 John Kenney deleted "Category:Suspense writers" (content was: '[[Category:Writers by genre]]')
- 22:34, 5 Jun 2004 Ahoerstemeier deleted "Silent Heroes" (content was: 'Yea go to www.cerulli.tk ,www.cerulligames.tk ,www.cerullitv.tk .Holla!!')
- 22:32, 5 Jun 2004 Guanaco deleted "Silent Heroes" (content was: 'Yea go to www.cerulli.tk ,www.ceruligames.tk ,www.cerullitv.tk .Holla!!')
- 22:27, 5 Jun 2004 Docu restored "Category:Topic_lists"
- 22:14, 5 Jun 2004 Guanaco deleted "Unlicensed Flying Object" (content was: 'Jenny. Hey, Trent.Trent. No! I watch my TV.Brad. It's called Zed.Tuck. Ha!')
- 22:06, 5 Jun 2004 UtherSRG deleted "The Home Page"
- 22:03, 5 Jun 2004 Bryan Derksen deleted "Category:South American Rivers" (content was: '#REDIRECT [[:Category:South American rivers]]' - so far, all my capitalization-related delete requests have been honoured without comment. So doing it myself this time to save effort. :))
- 21:40, 5 Jun 2004 Charles Matthews deleted "Transform" (content was: 'rawr')
- 21:35, 5 Jun 2004 UtherSRG deleted "Category:Asian Rivers" (content was: '#REDIRECT [[:Category:Asian rivers]]')
- 20:54, 5 Jun 2004 Maximus Rex deleted "Talk:Pugad Baboy" (content was: 'http://www.pmjunior.com.ph/strips/2.htm')
- 20:54, 5 Jun 2004 Ahoerstemeier deleted "Pugad Baboy" (content was: '[http://www.pmjunior.com.ph/strips/2.htm]pugad baboy{(msg:delete)} - no useful content.')
- 20:51, 5 Jun 2004 Guanaco deleted "Talk:Pawn (chess)" (content was: 'hi watvere')
- 20:49, 5 Jun 2004 Maximus Rex deleted "Pugad Baboy" (content was: '[http://www.pmjunior.com.ph/strips/2.htm]')
- 20:43, 5 Jun 2004 Guanaco deleted "Ole Kirk Christiansen" (michael, content was: 'Ole Kirk sucks due to the lack of info on him')
- 20:41, 5 Jun 2004 Maximus Rex deleted "Nikola Jurić" (content was: 'page under construction.It will be done on 2009/2010. season')
- 20:40, 5 Jun 2004 UtherSRG deleted "Category:Applied Cam" (content was: '{(delete)}')
- 20:37, 5 Jun 2004 Maximus Rex deleted "Kill 'em all and let God sort it out." (content was: 'A popular slogan among the anarchist movement.{(msg:stub)}')
- 20:37, 5 Jun 2004 Maximus Rex deleted "Color Field" (content before blanking was: 'Color field painting is using color as the main object of your painting.')
- 20:27, 5 Jun 2004 Guanaco deleted "Talk:Seal (1991 album)" (michael)
- 20:26, 5 Jun 2004 Guanaco deleted "Miscellaneous Debris" (michael)
- 20:24, 5 Jun 2004 Guanaco deleted "Lit (album)" (michael)
- 20:22, 5 Jun 2004 Guanaco deleted "The Jerky Boys 2" (michael)
- 20:21, 5 Jun 2004 Guanaco deleted "Tyrannosaurus Hives" (michael)
- 19:50, 5 Jun 2004 Maximus Rex deleted "Evil Rabid Jigglypuff of Doom" (nonsense)
- 19:48, 5 Jun 2004 UtherSRG deleted "Larkana" (content was: '{(delete)} - nonsense, google search says population of about 300,000, not 3 million: http://www.mongabay.com/igapo/Pakistan.htm . I just got another ...')
- 19:47, 5 Jun 2004 UtherSRG deleted "Only the person who risks"
- 19:46, 5 Jun 2004 UtherSRG deleted "Talk:EBay" (patent nonsense)
- 19:45, Jun 5, 2004 Minesweeper restored "Game_6"
- 19:44, Jun 5, 2004 Minesweeper deleted "Game 6" (delete to move page back here)
- 19:04, Jun 5, 2004 RedWolf deleted "Category talk:India" (content was: '[[India]] is a country in [[South Asia]].[[Category:South Asian countries]]')
- 18:21, 5 Jun 2004 Maximus Rex deleted "9 (album)" (content was: 'released in 1999')
- 18:16, Jun 5, 2004 Jengod deleted "Wheelbarrow position" (content was: ''''your browser's back button. Your addition to the encyclopedia will be visible immediately, so if you just want to test how things work, please do t...')
- 17:45, 5 Jun 2004 Guanaco deleted "Talk:Julius Streicher" (michael)
- 17:45, 5 Jun 2004 Guanaco deleted "Image talk:Harrisklebold.jpg" (michael)
- 17:44, 5 Jun 2004 Guanaco deleted "Talk:James Weldon Johnson" (michael)
- 17:43, 5 Jun 2004 Guanaco deleted "Super Bowls" (michael)
- 17:42, 5 Jun 2004 Ahoerstemeier deleted "Charles V of Naples" (content was: 'penis')
- 17:42, 5 Jun 2004 Guanaco deleted "The Jerky Boys 4" (michael)
- 17:40, 5 Jun 2004 Guanaco deleted "KROQ Top 106.7 Countdown of 2003" (michael)
- 17:27, 5 Jun 2004 Guanaco deleted "National Basketball Association Most Valuable Player Award" (michael)
- 17:27, 5 Jun 2004 Guanaco deleted "Chris Reece" (michael)
- 17:25, 5 Jun 2004 Guanaco deleted "Synarchist" (michael)
- 17:25, 5 Jun 2004 Tom- deleted "Heverlee" (content was: '{(delete)}mijn kot is daar')
- 17:25, 5 Jun 2004 Tom- deleted "Wicked Pictures" (content was: '{(delete)}redrosesingle loves you.')
- 17:25, 5 Jun 2004 Tom- deleted "Commonwealth Secondary" (Nonsese AOL-speak page)
- 17:25, 5 Jun 2004 Guanaco deleted "United States War Production Board" (michael)
- 17:24, 5 Jun 2004 Guanaco deleted "Ctarl-Ctarl" (michael)
- 17:24, 5 Jun 2004 Guanaco deleted "CKY (videos)" (michael)
- 17:23, 5 Jun 2004 Guanaco deleted "Talk:List of movies based on Saturday Night Live sketches" (michael)
- 17:23, 5 Jun 2004 Tom- deleted "US 69th Infantry Division" (content was: '[http://www.example.com link title]http://www.69th-Infantry-division.com/')
- 17:23, 5 Jun 2004 Guanaco deleted "South Miami Beach, Florida" (michael)
- 17:23, 5 Jun 2004 Tom- deleted "Experiment 617" (content was: '617 make me 36 ball for me I liva 215')
- 17:22, 5 Jun 2004 Tom- deleted "Doctor Dolittle 3" (Nonsese test page)
- 17:22, 5 Jun 2004 Guanaco deleted "Temple Cup" (michael)
- 17:21, 5 Jun 2004 Guanaco deleted "Home Grown" (michael)
- 17:21, 5 Jun 2004 Guanaco deleted "NBA Coach of the Year Award" (michael)
- 17:15, 5 Jun 2004 Guanaco deleted "Northwestern College (IA)" (michael)
- 17:14, 5 Jun 2004 Guanaco deleted "Hate core" (michael)
- 17:13, 5 Jun 2004 Guanaco deleted "NAIA national ice hockey championship" (michael)
- 17:12, 5 Jun 2004 Guanaco deleted "Hate edge" (michael)
- 17:11, 5 Jun 2004 Guanaco deleted "Key Arena" (michael)
- 17:07, 5 Jun 2004 Guanaco deleted "Johnny B." (michael)
- 17:06, 5 Jun 2004 Guanaco deleted "Talk:Debt restructuring" (michael)
- 17:05, 5 Jun 2004 Guanaco deleted "Intercollegiate Conference of Faculty Representatives" (michael)
- 17:05, 5 Jun 2004 Guanaco deleted "Milford Township, Butler County, Ohio" (michael)
- 17:05, 5 Jun 2004 Guanaco deleted "Dolcett" (michael)
- 17:05, 5 Jun 2004 Guanaco deleted "Frank Rizzo (Jerky Boys)" (michael)
- 17:03, 5 Jun 2004 Guanaco deleted "Kansas City-Omaha Kings" (michael)
- 17:02, 5 Jun 2004 Guanaco deleted "Kerplunk!" (michael)
- 17:01, 5 Jun 2004 Guanaco deleted "Transplants (album)" (michael)
- 17:00, 5 Jun 2004 Guanaco deleted "NAIA national baseball championship" (michael)
- 16:59, 5 Jun 2004 Guanaco deleted "NBA Rookie of the Year" (michael)
- 16:59, 5 Jun 2004 Guanaco deleted "Interprovincial Rugby Football Union" (michael)
- 16:55, 5 Jun 2004 Guanaco deleted "Jerky Boys: the Movie" (michael)
- 16:55, 5 Jun 2004 Guanaco deleted "The Jerky Boys (album)" (michael)
- 16:54, 5 Jun 2004 Guanaco deleted "Intercollegiate Athletic Association" (michael)
- 16:55, 5 Jun 2004 SimonP deleted "Marco Neumann" (content was: '{(delete)}')
- 16:55, 5 Jun 2004 SimonP deleted "Shiites in pakistan" (content was: '{(delete)}89p-[89[-09juju9u]')
- 16:53, 5 Jun 2004 Guanaco deleted "Talk:Kerosene lamp" (michael)
- 16:52, 5 Jun 2004 Guanaco deleted "Bethel College (Kansas)" (michael)
- 16:52, 5 Jun 2004 Guanaco deleted "St. Mary's University" (michael)
- 16:51, 5 Jun 2004 Guanaco deleted "Carey Estes Kefauver" (michael)
- 16:50, 5 Jun 2004 Guanaco deleted "The Jerky Boys 2" (michael)
- 16:48, 5 Jun 2004 Guanaco deleted "Arnulfo Arias Madrid" (michael)
- 16:47, 5 Jun 2004 Guanaco deleted "Christopher Lawford" (michael)
- 16:47, 5 Jun 2004 Guanaco deleted "Suzuka (Outlaw Star)" (michael)
- 16:45, 5 Jun 2004 Guanaco deleted "NCAA Women's Soccer Championship" (michael)
- 16:45, 5 Jun 2004 Guanaco deleted "Pacific 10 Conference" (michael)
- 16:44, 5 Jun 2004 Guanaco deleted "Tupa Inca Yupanqui" (michael)
- 16:39, 5 Jun 2004 Guanaco deleted "San Diego Clippers" (michael)
- 16:37, 5 Jun 2004 Snoyes deleted "Battle of Big Penis" (content was: 'The Epic PEEENNIS BattleIS ON''Italic text'' penis')
- 16:36, 5 Jun 2004 Guanaco deleted "Ribbentrop Bureau" (michael)
- 16:36, 5 Jun 2004 Guanaco deleted "Christopher Reece" (michael)
- 16:34, 5 Jun 2004 Guanaco deleted "World Team Tennis" (michael)
- 16:34, 5 Jun 2004 Guanaco deleted "Somewhere Between Heaven and Hell" (content was: ''''''Somewhere Between Heaven And Hell''''' is [[Social Distortion]]'s fourth album, released on [[February 11]], [[1992]].Also [[Social Distortio...')
- 16:33, 5 Jun 2004 Guanaco deleted "The Jerky Boys: the Movie (soundtrack)" (michael)
- 16:33, 5 Jun 2004 Guanaco deleted "Pod (rock album)" (broken redir, michael)
- 16:31, 5 Jun 2004 Guanaco deleted "Kansas City Kings" (michael)
- 16:30, 5 Jun 2004 Guanaco deleted "Deviant film" (michael, broken redir)
- 16:29, 5 Jun 2004 Guanaco deleted "Deviant films" (another broken redir by michael)
- 16:24, 5 Jun 2004 Guanaco deleted "Talk:Jeanne Crain" (michael)
- 16:22, 5 Jun 2004 Guanaco deleted "Josh Homme" (michael)
- 16:21, 5 Jun 2004 Guanaco deleted "The photo album" (michael)
- 16:20, 5 Jun 2004 Guanaco deleted "The Jerky Boys 3" (michael, broken redir)
- 16:21, 5 Jun 2004 Guanaco deleted "Talk:Jim Hellwig" (michael)
- 16:18, 5 Jun 2004 Guanaco deleted "The Velvet Revolver" (michael)
- 16:17, 5 Jun 2004 Guanaco deleted "Milwaukee Hawks" (michael)
- 16:17, 5 Jun 2004 Guanaco deleted "Chicago Zephyrs" (michael)
- 16:16, 5 Jun 2004 Guanaco deleted "All American Girls Professional Baseball League" (michael)
- 16:16, 5 Jun 2004 Mikkalai deleted "Rus (etimology)" (typo in name; no links here. content was: '#REDIRECT [[Etymology of Rus and derivatives]]')
- 16:14, 5 Jun 2004 Guanaco deleted "NBA All-Star Game" (michael)
- 16:10, 5 Jun 2004 Wile E. Heresiarch deleted "Gurgaon Business Services (India)" (consensus to delete on vfd)
- 16:05, 5 Jun 2004 Guanaco deleted "Florideophyceae" (content was: ''''This site is very very silly, it should have the complete scientific classifications for all the different species'''')
- 16:02, 5 Jun 2004 Guanaco deleted "US 69th Infantry Division" (content was: '[http://www.example.com link title]http://www.69thinfantry.division.com/')
- 15:38, 5 Jun 2004 UtherSRG deleted "Category:Dead people" (content was: '{(vfd)}')
- 15:37, 5 Jun 2004 RadicalBender deleted "B-2 Spirit" (Deleting to move B-2 Bomber back to B-2 Spirit)
- 15:36, 5 Jun 2004 UtherSRG deleted "Category:Data compression algorithms" (content was: 'dup of [[:Category:Compression algorithms]]')
- 15:30, 5 Jun 2004 Cecropia deleted "Pro-American sentiment" (Re-deleted per consensus after restoring only to extract text)
- 15:19, 5 Jun 2004 Cecropia restored "Pro-American_sentiment"
- 15:05, 5 Jun 2004 Jimfbleak deleted "Szlachcic" (dictionary definition of non-english word was: 'Member of [[szlachta]], [[noble]] of [[Polish-Lithuanian Commonwealth]].{(stub)}')
- 15:02, 5 Jun 2004 Jimfbleak deleted "ETV U.P." (content was: 'Official link www.eenadu.net')
- 14:52, 5 Jun 2004 Dysprosia deleted "Biginsanethingy" (ad)
- 12:55, 5 Jun 2004 WhisperToMe deleted "Thieve" (Mis-spelling content was: '#redirect [[Theft]]')
- 12:53, 5 Jun 2004 Danny deleted "Albadaya" (arabic language copyright violation)
- 12:25, Jun 5, 2004 Dori restored "Pier_Angeli"
- 12:22, Jun 5, 2004 Dori deleted "Pier Angeli" (in prep for fixing copy and paste move, will restore)
- 12:03, Jun 5, 2004 Cimon avaro deleted "PurePanties.com" (minorleague soft-porn site spam. Please stop undeleting this Antonio!)
- 11:28, 5 Jun 2004 Sverdrup restored "Techniques_and_resources_for_natural_language_processing"
- 11:27, 5 Jun 2004 Sverdrup deleted "Techniques and resources for natural language processing" (content was: 'i am lily')
- 09:35, 5 Jun 2004 Sverdrup deleted "MediaWiki:VfD-Iontophoresis" (redir target moved to talk; content was: '#redirect [[Template:VfD-Iontophoresis]]')
- 09:35, 5 Jun 2004 Sverdrup deleted "Template:VfD-Iontophoresis" (moved to talk; content was: '#REDIRECT [[Talk:Iontophoresis/deletion]]')
- 09:17, 5 Jun 2004 Sverdrup deleted "Slingsby T67M Firefly II" (content was: '<math>Insert formula here</math>== Headline text ==[[Link title]]''Italic text'''''Bold text'''<nowiki>Insert non-formatted text here</nowiki>--[[Us...')
- 08:33, 5 Jun 2004 Maximus Rex deleted "Asingan, Pangasinan" (content was: 'map of asingan, pangasinan')
- 08:26, 5 Jun 2004 Wile E. Heresiarch deleted "Mossy" (speed delete patent nonsense)
- 08:12, 5 Jun 2004 Morwen deleted "Lord of the Flies" (content was: '#REDIRECT [[Lord of the Flies (phrase)]]')
- 06:36, 5 Jun 2004 Theresa knott deleted "User:Wik/Talk/Wik" (content was: '.')
- 06:35, 5 Jun 2004 Maximus Rex deleted "Image:<a href="http://www.memory-alpha.org/en/upload/b/b4/UFP-Seal.jpg" class='external' title="http://www.memory-alpha.org/en/upload/b/b4/UFP-Seal.jpg">http://www.memory-alpha.org/en/upload/b/b4/UFP-Seal.jpg</a>" (not an image)
- 06:33, 5 Jun 2004 Francs2000 deleted "Lists of solo cello pieces" (content was: '[[Category:List of pieces]]')
- 06:30, 5 Jun 2004 Maximus Rex deleted "Talk:Guaifenesin" (profanity)
- 06:25, 5 Jun 2004 Maximus Rex deleted "Guaifenesin" (profanity)
- 06:13, 5 Jun 2004 Bryan Derksen deleted "Category:American politicians" (content was: '[[Category:Politicians by nationality]]' I'm a dummy, there's already Category:U.S. politicians)
- 05:58, 5 Jun 2004 Cyrius deleted "Peter Pan (2003 movie)" (content was: 'Hey I think Peter Pan is one of my fav movies I have seen and got. Jeremy played a good Peter Pan and he is hot. The is really cool and I'm glade u gu...')
- 05:57, 5 Jun 2004 Guanaco deleted "Robert White" (BJAODN/MBJTYCSTSA)
- 05:50, 5 Jun 2004 Guanaco restored "Talk:Powers_(comic)"
- 05:49, 5 Jun 2004 Guanaco deleted "Talk:Powers (comic)" (content was: '{(delete)}I just wrote this and then found someone else wrote [[Powers (comics)]] on the same subject last week. I'll let a neutral third party take ...')
- 05:47, 5 Jun 2004 Guanaco deleted "Little Jimmy Urine" (content was: '{(delete)}eric l elder is a great freaking drummer!')
- 05:36, 5 Jun 2004 Guanaco deleted "Lady Bird (King of the Hill)" (content was: '{(delete)}Hank's Dog')
- 05:35, 5 Jun 2004 Guanaco deleted "Maithili" (content was: '{(delete)}Who is maithili-Your aunt or ur Saas')
- 05:35, 5 Jun 2004 Guanaco deleted "Sully Erna" (content was: 'Born: February 7, 1968 Lawrence, MA, USA; is a practicing Wiccan')
- 05:30, Jun 5, 2004 RickK deleted "AARDVARK" (content was: 'HAHAHA I HAX0RED THE WIKI!!#$!#%!!!!!11111oneoneoneelevenelvene{(delete)}')
- 05:13, 5 Jun 2004 Guanaco restored "User:Wik/Talk/Wik"
- 05:13, 5 Jun 2004 Maximus Rex deleted "Shwag" (content was: 'over weight unamerican')
- 05:09, 5 Jun 2004 Guanaco deleted "Shwag" (content was: 'over weight unamerican')
- 05:07, 5 Jun 2004 Guanaco deleted "Category:Television Shows" (content was: '[[Television show]]s are [[show]]s on [[television]].[[Category:Television]]')
- 05:07, 5 Jun 2004 Guanaco deleted "Category:Sketch Comedy Shows" (content was: '#REDIRECT [[:Category:Sketch comedy shows]]')
- 05:06, 5 Jun 2004 Guanaco deleted "Category:Topic lists" (content before blanking was: 'These lists provide a broad overview of all articles by category. If they are alphabetical, they are ideally converted to [[Special:Categories]].See...')
- 04:53, 5 Jun 2004 Guanaco deleted "Pro-American sentiment" (VfD consensus to delete)
- 04:40, 5 Jun 2004 Guanaco deleted "Pokémon Junior" (VfD consensus to delete)
- 04:38, 5 Jun 2004 UtherSRG deleted "Moving" (content was: ' <Runningzi> havent seen karppa around lately, probably too busy drinking, the mircing is on a standby')
- 04:35, 5 Jun 2004 Guanaco deleted "Image:Bi flag large.png" (was uploaded with wrong filename)
- 04:26, 5 Jun 2004 UtherSRG deleted "No. II Squadron RAF" (content was: '== Headline text = single it wanted to know but of this information I am loving of these ships and a lover of tecnologia of American end my serio...')
- 04:26, 5 Jun 2004 Guanaco deleted "User:Equilibrium" (nonsense user page created by anon)
- 04:23, 5 Jun 2004 Texture deleted "Quasi-steady state theory" (content was: 'lets get loud')
- 04:16, Jun 5, 2004 Dori deleted "Mip-mapping" (content was: 'Wocka wocka wocka!')
- 04:16, Jun 5, 2004 Dori deleted "Talk:Mip-mapping" (testing garbage)
- 04:03, 5 Jun 2004 UtherSRG deleted "Panthers World of Entertainment" (content was: 'Panthers World of Entertainment is a large club in the city of [[Penrith, Australia]]. Some of the services offered within the club include a gaming a...')
- 04:01, 5 Jun 2004 UtherSRG deleted "Category:Postmodernism" (content before blanking was: 'See the full-length article [[Postmodernism]].[[Category:Critical_theory]]')
- 03:59, 5 Jun 2004 UtherSRG deleted "Category:Specific Calendars" (content was: '#REDIRECT [[:Category:Specific calendars]]')
- 03:59, 5 Jun 2004 UtherSRG deleted "Category:Science fiction books" (content was: 'See instead [[:Category:Science fiction novels]].')
- 03:57, 5 Jun 2004 UtherSRG deleted "Category:Death gods" (content was: 'This category is for deities that are associated with death, the dead, and/or the afterlife.[[Category:Gods]]')
- 03:57, 5 Jun 2004 UtherSRG deleted "Category:European Rivers" (content before blanking was: '[[Category:Rivers]][[Category:European Geography]]')
- 03:57, 5 Jun 2004 UtherSRG deleted "Category:United States Wars" (content was: '#REDIRECT [[:Category:United States wars]]')
- 03:56, 5 Jun 2004 UtherSRG deleted "Category:World War II German jet fighter aircraft" (content before blanking was: '[[Category:World_War_II_German_jet_aircraft]][[Category:World_War_II_German_fighter_aircraft]]')
- 03:52, 5 Jun 2004 Guanaco deleted "Marco Antonio Muniz" (self-promotion, soliciting funds)
- 03:51, 5 Jun 2004 Guanaco deleted "Principles" (broken redir)
- 03:35, 5 Jun 2004 Maximus Rex deleted "Like Father like Clown" (content was: '{(delete)}''''<math>== 'Bold text'''== Headline text ==WE GOIN DO IT LIKE THIS OMPRECORDS IS ONNA RISE ELG IS ONNA RIZE IF YOU DONT KNOW THE NAME...')
- 03:25, 5 Jun 2004 Texture deleted "Upright doggy position" (content was: ''''Bold text''' man sits down legs out penis up women sits down in a upright possiton slightly bending over sits on mans penis with her vigina and rid...')
- 03:18, 5 Jun 2004 Maximus Rex deleted "Music of Eritrea" (content was: ' TEgregha')
- 03:18, 5 Jun 2004 Maximus Rex deleted "Sars b teh ugleh" (content was: '{(delete)}Sars b teh ugleh')
- 03:17, Jun 5, 2004 Flockmeal deleted "Kaj b teh ugleher" (content was: 'Kaj b teh ugleher')
- 02:40, 5 Jun 2004 Bkonrad deleted "User:Bkonrad/List of U.S. Treaties" (content was: '#REDIRECT [[List of U.S. Treaties]]' (this time I got the redirect instead of the article!!!))
- 02:38, 5 Jun 2004 Bkonrad restored "List_of_U.S._Treaties"
- 02:37, 5 Jun 2004 Bkonrad deleted "List of U.S. Treaties" (a no longer needed, self-created temp page in my user namespace)
- 01:36, 5 Jun 2004 Texture deleted "Category:Calendar" (content was: '{(msg:Delete)} correct name should be ''Calendars''')
- 01:36, 5 Jun 2004 Texture deleted "Raether" (content was: '{(msg:delete)}Raether is a German last name. It is very common in the US and Germanic Europe. The most common URLs for this name have already been t...')
- 01:34, 5 Jun 2004 Dpbsmith deleted "How to rehearse" (Deleted per VfD consensus)
- 01:32, 5 Jun 2004 Texture deleted "WWE Velocity" (content was: '{(msg:delete)}WWE Velocity is a show that comes on every Saturday night on Spike TV!')
- 01:30, 5 Jun 2004 Texture deleted "Correspondence course" (content was: '{(msg:delete)}==External Links==[http://www.rxpgonline.com Medical Education]')
- 01:27, 5 Jun 2004 Texture deleted "DOVEY" (content was: 'Fat ass and annoying person from #theshortbus on EFnet.#1[[Image:http://www.stolemyinter.net/uploads/35paint.jpg]]#2[[Image:http://www.stolemyin...')
- 01:04, 5 Jun 2004 Meelar deleted "Talk:Action=random" (again)
- 01:01, 5 Jun 2004 Wile E. Heresiarch deleted "Michael Mazengarb" (listed on vfd, consensus to delete)
- 00:59, 5 Jun 2004 Meelar deleted "Talk:Action=random" (same old)
- 00:58, 5 Jun 2004 Meelar deleted "Talk:Action=random" (nonsense)
- 00:55, 5 Jun 2004 Meelar deleted "Action=random" (nonsense)
- 00:54, 5 Jun 2004 Meelar deleted "Talk:Action=random" (nonsense)
- 00:52, Jun 5, 2004 Dori deleted "Biometry" (content was: '{(msg:delete)}hey[[Media:Example.ogg]][http://www.example.com link title][[Link title]]''Italic text'''''Bold text'''== Headline text ==[[Media:E...')
- 00:49, 5 Jun 2004 John Kenney deleted "Tacitus" (content was: '#REDIRECT [[Tacitus (old)]]')
- 00:48, 5 Jun 2004 Wile E. Heresiarch deleted "Talk:David Frenk" (talk page of deleted article)
- 00:48, 5 Jun 2004 Wile E. Heresiarch deleted "David Frenk" (listed on vfd, consensus to delete)
- 00:47, 5 Jun 2004 Timwi deleted "CIA" (fix link table corruption)
- 00:46, 5 Jun 2004 Maximus Rex deleted "Action=random" (not english and not an article)
- 00:44, 5 Jun 2004 Wile E. Heresiarch deleted "Juls" (listed on vfd, no votes to keep)
- 00:44, 5 Jun 2004 Timwi deleted "User:%/monobook.css" (test didn't work out)
- 00:42, 5 Jun 2004 Meelar deleted "Action=random" (portuguese (?), poor format, etc)
- 23:32, 4 Jun 2004 Sverdrup deleted "Indian People's Theatre Association" (content was: '' <bobsmith1942tongue@freeola.com> To: black_prince@wowmail.com, coast23@wowmail.com,doc4doc@wowmail.com, ebby12@wowmail.com, golfcaddie67@...')
- 23:19, 4 Jun 2004 Texture deleted "Angel investor" (content was: ''''Bold text'''== Headline text ==kiuoiuoiu------------<math>Insert formula here</math>[[Media:Example.ogg]][[Image:Example.jpg]][[Link title]]''...')
- 23:16, 4 Jun 2004 Texture deleted "Godwins Law/" (content was: 'Godwin, another disciple of captain obvious')
- 23:15, 4 Jun 2004 Texture deleted "Talk:Godwins Law/" (content was: 'Another disciple of captain obvious')
- 23:02, 4 Jun 2004 Francs2000 deleted "Joe Forehand" (content was: 'http://www.forbes.com/finance/mktguideapps/personinfo/FromMktGuideIdPersonTearsheet.jhtml?passedMktGuideId=188456')
- 22:52, 4 Jun 2004 Jiang deleted "MediaWiki:PPROC" (content was: '#redirect [[Template:PPROC]]')
- 22:46, 4 Jun 2004 Tom- deleted "Orlando Web Design" (Advert)
- 22:40, 4 Jun 2004 Jiang deleted "MediaWiki:LiteratureLaureates" (content was: '#redirect [[Template:LiteratureLaureates]]')
- 22:39, 4 Jun 2004 Guanaco deleted "User:Guanaco/Cabal"
- 22:29, 4 Jun 2004 Francs2000 deleted "Dark ages of camelot" (content was: 'MMORPG produced by Mythic Entertainment')
- 22:28, 4 Jun 2004 Francs2000 deleted "Amanda Serpico" (content was: 'hi my name is amanda. whats yours?')
- 22:27, 4 Jun 2004 Francs2000 deleted "KU Edwards Campus" (content was: '[http://edwardscampus.ku.edu]')
- 22:02, 4 Jun 2004 Infrogmation deleted "Ro (pharaoh)" (content was: text in Portugese.)
- 22:01, 4 Jun 2004 Francs2000 deleted "Freakimus" (content was: 'A fat 8 year old [[b3ta]] member whose diet consists entirely of Dr. Pepper and fired monkeys ears, it is often mentionsed, 'Hey, wheres freakimus? I ...')
- 22:00, 4 Jun 2004 Infrogmation deleted "Antenne 2" (content was: 'a doudoudoudou{(msg:delete)}')
- 22:00, 4 Jun 2004 Infrogmation deleted "Closed format" (content was: '{(msg:delete)}That format which is not open. See [[open format]].')
- 21:58, 4 Jun 2004 Francs2000 deleted "Ploaghe" (content was: '{(msg:delete)}Ploaghe it's a nuragic site that was constrected by the nuragic people. But in the middle years of arcaic times the tribù of Magic Han...')
- 21:56, 4 Jun 2004 Francs2000 deleted "Ploaghe" (content was: 'Ploaghe it's a nuragic site that was constrected by the nuragic people. But in the middle years of arcaic times the tribù of Magic Hand (Manu Trota) d...')
- 21:56, 4 Jun 2004 Francs2000 deleted "Massimo Pittau" (content was: 'Durante la migrazione dei popoli anatolici la Sardegna era là davanti, impossibile non incontrarla in mezzo al mare.')
- 21:55, 4 Jun 2004 Francs2000 deleted "List of television shows distributed from Germany" (content was: '[http://NLNtv.com]')
- 21:53, 4 Jun 2004 Francs2000 deleted "Viola Chen" (content was: '== Headline text ==ttttttt')
- 21:18, 4 Jun 2004 DJ Clayworth deleted "South African special forces" (speedy deleted under the 'no useful content' clause)
- 21:14, 4 Jun 2004 Francs2000 deleted "Legend of the Green Dragon" (content was: '<h1><b>why isnt this page here yet</b></h1>')
- 21:13, 4 Jun 2004 Francs2000 deleted "Radio France Internationale" (content was: 'Mike Licause = h4ck3r supr3m3')
- 21:13, 4 Jun 2004 Francs2000 deleted "Marilyn Tucker" (content was: 'Dan Quayle's wife.')
- 20:53, 4 Jun 2004 Maximus Rex deleted "Nichalp archive 1" (content was: '#REDIRECT [[User talk:Nichalp/Archive 1]]')
- 20:47, 4 Jun 2004 Cyrius restored "Croat_Catholic_Ustashi_clergy"
- 20:46, 4 Jun 2004 Maximus Rex deleted "Loais" (content before blanking was: '*REDIRECT [[County Loais]]' (doesn't exist))
- 20:46, 4 Jun 2004 Maximus Rex deleted "Wikipolice" (content was: 'Please see [http://en.wikipedia.org/wiki/Wikipedia:Wikipolice]')
- 20:38, Jun 4, 2004 Morven deleted "Image:Ford Ka.jpg" (Uploaded under wrong name, going to re-upload)
- 20:35, 4 Jun 2004 Cyrius deleted "Nothlit (Animorphs)" (VfD - consensus to delete)
- 20:33, 4 Jun 2004 Cyrius deleted "Kassandra Hiroshima" (VfD - consensus to delete)
- 20:32, 4 Jun 2004 Cyrius deleted "MediaWiki:VfD-Mr.Bits" (unneeded VfD redirect)
- 20:31, 4 Jun 2004 Cyrius deleted "MediaWiki:VfD-MrBits" (unneeded VfD redirect)
- 20:32, 4 Jun 2004 Cyrius deleted "MediaWiki:VfD-debate Mr.Bits" (unneeded VfD redirect)
- 20:31, 4 Jun 2004 Cyrius deleted "Template:VfD-Mr.Bits" (unneeded VfD redirect)
- 20:30, 4 Jun 2004 Cyrius deleted "Mr.Bits" (VfD - consensus to delete)
- 20:29, Jun 4, 2004 Dori restored "Movimento_Sociale_Italiano"
- 20:26, Jun 4, 2004 Dori deleted "Movimento Sociale Italiano" (in prep for move, content was: '#REDIRECT [[Movimento Social Italiano]]')
- 20:26, 4 Jun 2004 Mirv deleted "Croat Catholic Ustashi clergy" (Recreation of previously-deleted page ([[Wikipedia:Candidates for speedy deletion]], #5))
- 20:23, 4 Jun 2004 DavidWBrooks deleted "Bronson Avenue" (content was: 'Named after a local lumber baron, who owned and operated mills and yards in the area.')
- 19:57, Jun 4, 2004 Dori deleted "User:Dori/Monobook.css" (content was: '#REDIRECT [[User:Dori/monobook.css]]')
- 19:54, 4 Jun 2004 Francs2000 deleted "Operation Cochise" (content was: 'pants are ugly you bastard!!!!')
- 19:50, 4 Jun 2004 Maximus Rex deleted "Wikipedia:Wikipedians/United Arab Emirates" (content was: 'The following Wikipedians are from [[UAE|United Arab Emirates]] or live in UAE:# [[User:Jimbo The troll Slayer|Jimbo the troll slayer]]')
- 19:45, 4 Jun 2004 Francs2000 deleted "Citizens Military Force" (broken redirect blanked by author)
- 19:43, Jun 4, 2004 RickK deleted "Chosin reservoir" (content was: 'ya hi to y'all that survived in the vietnanm war i just wanted to say thank you to all that survived for our country it means a lot to everyone thank ...')
- 19:43, 4 Jun 2004 Francs2000 deleted "English-Chinese translation" (content was: 'I wish someone posts an article in order to enlight users on this matter.Lima-Pereira, Brazil.')
- 19:41, Jun 4, 2004 RickK deleted "Dieter Gieseking" (German, copyvio)
- 19:38, 4 Jun 2004 Francs2000 deleted "Folder/subfolder/wikipage" (content was: 'it seems that is is possible to have a slash in the wikipage name')
- 19:30, 4 Jun 2004 Francs2000 deleted "Infophp" (content was: '[http://www.infophp.com INFOPHP.com]PHP information and hostinginfo@infophp.com')
- 19:30, Jun 4, 2004 RickK deleted "Coletta Jordan" (patent nonsense)
- 19:28, 4 Jun 2004 Francs2000 deleted "Wikipolice" (content was: 'Why do you delete articles without discussions ?')
- 19:27, Jun 4, 2004 RickK deleted "User notepad:Xeroc" (moved to User space)
- 19:26, 4 Jun 2004 Francs2000 deleted "Zhang Zhizhong" (content was: 'never heard of this guy')
- 19:13, 4 Jun 2004 DavidWBrooks deleted "Christmas party" (content was: '== Water balloon cannon for your christmas party games. ==The above link provides information on making entertaiing childrens christmas parties with...')
- 19:01, Jun 4, 2004 RickK deleted "<i >Paladin class starship" (content was: '<b>Paladin Class StarshipType of battle carrier bigger than the [[<i>Ares class starship]].')
- 19:01, Jun 4, 2004 RickK deleted "U.S.S. Enterprise NCC-1701-F" (content was: '<b>U.S.S. Enterprise NCC-1701-F[[<i>Paladin class starship]]')
- 18:52, Jun 4, 2004 RickK deleted "Larry O'Brien" (content was: ''''Bold text'''he was a funny guy!! he dated nixon')
- 18:45, 4 Jun 2004 DavidWBrooks deleted "Einstein's Puzzle/Temp" (temp page, no longer needed)
- 18:39, 4 Jun 2004 Warofdreams deleted "Things" (content was: '{(msg:delete)}(This is a dictionary definition. see [[Wiktionary]] [[User:Duncharris|Dunc_Harris]]|[[User talk:duncharris|☺]] 14:24, 4 Jun 20...')
- 18:36, 4 Jun 2004 UtherSRG deleted "Category:Dictators" (content was: ':''This page has been listed on [[Wikipedia:Votes for deletion]]. Please see [[Wikipedia:Votes_for_deletion#{(PAGENAME)}|its entry on that page]] for ...')
- 18:35, 4 Jun 2004 UtherSRG deleted "Category talk:Dictators"
- 18:34, 4 Jun 2004 UtherSRG deleted "Category:Japanese transportation" (content was: '[[Transportation in Japan]][[Category:Japan]]')
- 18:33, 4 Jun 2004 UtherSRG deleted "Category:Airports of Columbia" (content was: ':''This page has been listed on [[Wikipedia:Votes for deletion]]. Please see [[Wikipedia:Votes_for_deletion#{(PAGENAME)}|its entry on that page]] for ...')
- 18:33, 4 Jun 2004 UtherSRG deleted "Category:Japanese railway companies" (content was: '==See also==*[[List of railway companies in Japan]][[Category:Japanese transportation]]')
- 18:33, 4 Jun 2004 UtherSRG deleted "Category:Japanese railway lines" (content was: '[[Category:Japanese transportation]]')
- 18:33, 4 Jun 2004 UtherSRG deleted "Category:Japanese airline companies" (content was: '[[Category:Japanese transportation]]')
- 18:32, 4 Jun 2004 UtherSRG deleted "Category:Computer magazine" (content was: 'Moved to [[:Category:Computer magazines]]')
- 18:32, 4 Jun 2004 UtherSRG deleted "Category:Magazine" (content was: 'Moved to [[:Category:Magazines]]')
- 18:32, 4 Jun 2004 UtherSRG deleted "Category:Harry Potter Books" (content was: 'Books about [[Harry Potter]].')
- 18:21, 4 Jun 2004 Cyrius deleted "Talk:Unidentified flying object" (deleting for page move)
- 18:22, 4 Jun 2004 Cyrius deleted "Unidentified flying object" (Deleting for page move)
- 18:17, 4 Jun 2004 Texture deleted "What the Butler Saw" (content was: 'You can see this play for free at Stella Adler Academy of Acting in Los Angeles in June 2004. For more information please call 1(323)465-4446 or chec...')
- 18:17, 4 Jun 2004 DavidWBrooks deleted "Charlie Benante" (content was: '''Italic thext'''''Bold text'''')
- 18:15, 4 Jun 2004 DavidWBrooks deleted "What the Butler Saw" (content was: 'You can see this play for free at Stella Adler Academy of Acting in Los Angeles in June 2004. For more information please call 1(323)465-4446 or chec...')
- 18:13, 4 Jun 2004 Secretlondon deleted "What the Butler Saw" (content was: 'You can see this play for free at Stella Adler Academy of Acting in Los Angeles in Jun 2004. For more information please call 1(323)465-4446 or check...')
- 18:05, 4 Jun 2004 DavidWBrooks deleted "Southern Vowel Shift" (copyvio, non-encyclopedic)
- 18:04, 4 Jun 2004 Warofdreams deleted "Descriptive grammar" (content was: '== Headline text ==hola a todos la gramática es muy divertida por sus múltiples usos esoero que diviertan aprendiendola.!!!!! chao.....')
- 18:04, 4 Jun 2004 Warofdreams deleted "Venetian Hotel" (content was: 'prices for the vention hotel')
- 18:03, 4 Jun 2004 LouI deleted "Salem (village), Washington County, New York" (Not needed, only history was Rambot; content was: '#REDIRECT [[Salem (village), New York]]')
- 18:03, 4 Jun 2004 Warofdreams deleted "What the Butler Saw" (content was: ' You can see this play for free at Stella Adler Academy of Acting in Los Angeles on Jun 18, Jun 19 8pm, Jun 20 7pm, Jun 23-Jun 26 8pm, Jun 27 7pm 20...')
- 18:00, 4 Jun 2004 LouI deleted "Salem (town), Washington County, New York" (Not needed, only history was Rambot; content was: '#REDIRECT [[Salem (town), New York]]')
- 17:43, 4 Jun 2004 DavidWBrooks deleted "Tomius J. Barnard" (piffle)
- 17:41, 4 Jun 2004 Niteowlneils deleted "Ear pinnae" (content was: 'Max is the man' patent nonsense)
- 17:39, 4 Jun 2004 Niteowlneils deleted "Outrage!" (blank article)
- 17:36, 4 Jun 2004 Maximus Rex deleted "Heavy Metal: F.A.K.K. 2" (content was: 'BOE *SCHRIK* *BA*{(msg:delete)}')
- 17:34, 4 Jun 2004 Maximus Rex deleted "Hand-to-hand" (content was: '{(msg:delete)}attacking someone hand to hand')
- 17:25, 4 Jun 2004 DavidWBrooks deleted "We the People Party" (content was: '{(msg:delete)}NONE')
- 17:24, 4 Jun 2004 Timwi deleted "User:Timwi/Temp"
- 17:24, 4 Jun 2004 Niteowlneils deleted "Salisbury, George" (content was: 'George Salisbury resides in Norman, Oklahoma. USA.He has red hair and an energy that is both creative and nervous.' not notable nonsense)
- 17:19, 4 Jun 2004 Timwi deleted "User:Timwi/Test" (content was: '#REDIRECT [[Central Intelligence Agency]]')
- 17:19, 4 Jun 2004 Timwi deleted "User:Timwi/Test2" (content was: '#REDIRECT [[CIA]]')
- 17:11, 4 Jun 2004 DavidWBrooks deleted "Forces of Nature" (content was: 'I loved your movie. It was super, dude. Gotta ran.Catch ya later. From Tara Johnson')
- 17:10, 4 Jun 2004 DavidWBrooks deleted "Peaches (single)" (content was: '{(msg:delete)}Peaches is an awesome song!')
- 17:05, 4 Jun 2004 Niteowlneils deleted "Carlos Libedinsky" (content was: '{(msg:delete)}==External Links==http://www.carloslibedinsky.com' WP is not a link farm)
- 17:05, 4 Jun 2004 Guanaco deleted "Wikipedia:Requests for comment/Red Faction" (troll food)
- 17:02, 4 Jun 2004 Niteowlneils deleted "Gotan Project" (content was: '{(msg:delete)}==External Links==http://www.gotanproject.com/' WP is not a link farm)
- 17:01, 4 Jun 2004 DavidWBrooks deleted "Vteen.com" (content was: 'Good site. [[City Jumper]]')
- 17:01, 4 Jun 2004 DavidWBrooks deleted "Steven Drozd" (content was: 'Steven 'long O' Drozd')
- 17:01, 4 Jun 2004 DavidWBrooks deleted "Outrage" (content before blanking was: '*[[Outrage]]! (with exclamation mark) is a radical [[gay rights]] [[activist]] group in the [[United Kingdom]].')
- 17:01, 4 Jun 2004 DavidWBrooks deleted "Quigley" (content was: 'On of the most well know Quigley's is Patrick Quigley. He and his wife Nicole live in Norman, OK')
- 17:00, 4 Jun 2004 DavidWBrooks deleted "Gotan Project" (content was: '==External Links==http://www.gotanproject.com/')
- 17:00, 4 Jun 2004 DavidWBrooks deleted "Sears Advertising Schemes" (content was: '{(msg:delete)}'''Sears Advertising Schemes''' are a series of obviously naive strategies to lure customers into buying their expensive products.He...')
- 17:00, 4 Jun 2004 DavidWBrooks deleted "Pootpoot" (content was: ''''Pootpoot''' is a website that has the ability to turn any webpage into ''pootpoot''. For source and a test see [www.pootpoot.com/pootify].http://...')
- 16:52, 4 Jun 2004 Timwi deleted "Project paperclip" (fixing link table corruption... :/)
- 16:33, 4 Jun 2004 Timwi restored "CIA"
- 16:32, 4 Jun 2004 Timwi deleted "Wikipedia:Redirect testing (I'll delete this later)" (content was: '#REDIRECT [[CIA]]')
- 16:31, 4 Jun 2004 Timwi restored "Wikipedia:Redirect_testing_(I'll_delete_this_later)"
- 16:23, 4 Jun 2004 DavidWBrooks deleted "Dry milk" (dead end stub, confused and repetitive of [[Western blotting]])
- 16:19, 4 Jun 2004 DavidWBrooks deleted "Deception and manipulation by animals" (dead-end stub, unnecessary repeat of material elsewhere)
- 16:13, 4 Jun 2004 Timwi deleted "Wikipedia:Redirect testing (I'll delete this later)" (content was: '#REDIRECT [[CIA]]')
- 14:46, 4 Jun 2004 Dpbsmith deleted "Radium (SA)" (Arrant nonsense)
- 14:27, 4 Jun 2004 Charles Matthews deleted "Justin Wowk" (content was: 'this kid is gay, f00{(msg:delete)}')
- 13:46, 4 Jun 2004 DavidWBrooks deleted "William Stanley (Battle of Bosworth)" (confused, redundant, badly titled, possibly wrong)
- 13:34, 4 Jun 2004 DavidWBrooks deleted "Rongerik Atoll" (content was: '--[[User:204.60.97.2|204.60.97.2]] 13:30, 4 Jun 2004 (UTC)--[[User:204.60.97.2|204.60.97.2]] 13:30, 4 Jun 2004 (UTC)--[[User:204.60.97.2|204.60.97.2]]...')
- 13:20, 4 Jun 2004 DavidWBrooks deleted "Hary Potter and the Prisoner of Azkaban" (misspelled, redundant)
- 13:07, 4 Jun 2004 DavidWBrooks deleted ""school""
- 13:01, 4 Jun 2004 DavidWBrooks deleted "Settlements On The Amazon"
- 13:00, 4 Jun 2004 DavidWBrooks deleted ""Settlements On The Amazon""
- 12:56, 4 Jun 2004 DavidWBrooks deleted ""School""
- 12:55, 4 Jun 2004 DavidWBrooks deleted ""school""
- 12:30, 4 Jun 2004 Ahoerstemeier deleted "Talk:"Settlements On The Amazon"" (content was the same as in the article itself, no need for repetition)
- 12:28, Jun 4, 2004 Zanimum deleted "" Settlements On The Amazon"" (repeat of Settlements On the Amazon)
- 11:59, 4 Jun 2004 UtherSRG deleted "Chiang Yang-shih" (content was: '{(msg:delete)}A light armoured ancient Chinese fairy. Its tremendous speed allows it to defend China against multiple hostile fighter jets. The fair...')
- 11:58, 4 Jun 2004 UtherSRG deleted "Importance" (content was: ''''Importance''' is the quality or state of being important of something or of an action.The estimation of the importance depends is subjective.The...')
- 11:59, 4 Jun 2004 UtherSRG deleted "Talk:Eynhallow" (content was: 'Hi is the Wiki working?{(delete)}I can't seme to make my edits appera. [[User:Duncharris|Dunc_Harris]]|[[User talk:duncharris|☺]] 11:45, 4 J...')
- 11:58, 4 Jun 2004 UtherSRG deleted "Saturation arithmetic" (content was: '{(msg:delete)}hello')
- 10:38, 4 Jun 2004 Ahoerstemeier deleted "Redeye (band)" (content was: '{(msg:delete)}Could this be for the band Redeye from SoCal (OC area) in the 70's, with the 'hit' song ''Games''???? I knew a couple of the guys in ...')
- 10:37, 4 Jun 2004 Ahoerstemeier deleted "Paradromic ring" (content was: 'tested')
- 09:15, 4 Jun 2004 Sverdrup deleted "Fump" (content was: '{(msg:delete)}FUMPInternational instrumentalists encouraging new members to join in!Contact: John ChambersMembers: Johanna Bobrow, John Chamb...')
- 08:45, 4 Jun 2004 Ahoerstemeier deleted "My Heart Will Go On" (content was: 'My Heart Will Go On is started in 1187562861074. It was started by Mr. SingapuraBlablabla. A song for Titanic, it used nonsensical words like pick-a-b...')
- 08:43, 4 Jun 2004 Ahoerstemeier deleted "Stanley Tweedle" (content was: 'http://www.sadgeezer.com/lexx')
- 08:34, 4 Jun 2004 Sverdrup deleted "1962 in art" (content was: '<nowiki>Insert non-formatted text here</nowiki>')
- 08:19, 4 Jun 2004 Hadal deleted "Megola" (content was: ''''Bold text'''[[Image:Example.jpg]]<nowiki>Insert non-formatted text here</nowiki>')
- 07:58, 4 Jun 2004 Hadal deleted "Vincent Choi" (content was: '{(msg:delete)}A major figure in the early Christian countercult movement. Also, a god of [[thunderstorm]]s and [[fast dancing]]. Also, one of the ...')
- 07:55, 4 Jun 2004 Hadal deleted "Xuddur" (nonsense)
- 07:52, 4 Jun 2004 Hadal deleted "List of Croatian language radio stations" (content was: 'radio cakovec 98.o/99.5FM{(msg:delete)}')
- 07:49, 4 Jun 2004 Hadal deleted "Fump.com" (content was: '{(msg:delete)}[[www.fump.com]] is an almost completely empty web domain bearing only a red background and the title, 'FUMP.com'')
- 07:36, 4 Jun 2004 Jimfbleak deleted "Stanley J. Kalisch III" (content was: 'Troll. spammer. blah.')
- 07:08, Jun 4, 2004 RickK deleted "List of advertisement agencies" (content was: 'Email marketting [http://thelanka.com Personal Targeted Email]')
- 07:02, Jun 4, 2004 RickK deleted "United States of America Constitution" (source text of the constitution, bad capitalization, HTML attempt in title)
- 06:43, 4 Jun 2004 Docu restored "Category:Sport"
- 06:41, Jun 4, 2004 RickK deleted "Write to Andznavur" (content was: 'Happy birthday to you Happy birthday to youHappy birthday dear Charle AndznzvourHappy birthday to you Hello dear Andznavour I`m in ...')
- 06:41, 4 Jun 2004 Cyrius deleted "Vollis" (VfD - consensus to delete)
- 06:36, 4 Jun 2004 Cyrius deleted "Template:VfD-KonsoleKalendar" (unneeded VfD redirect)
- 06:36, 4 Jun 2004 Hadal deleted "Skin disease" (content was: ''''Bold text'''== Headline text ==<nowiki>Insert non-formatted text here</nowiki>----[http://www.example.com link title]''Italic text''[[Link titl...')
- 06:19, Jun 4, 2004 RickK deleted "Pac-Man Collection" (content was: 'F2a lets you dfowload over 35 different gba roms on to 1 card never buy games againTYPE F2A INTO GOOGLE')
- 06:17, Jun 4, 2004 RickK deleted "Puyo Pop" (content was: 'TYPE F@A IN GOOGLE ANT BE AMAzED')
- 06:16, Jun 4, 2004 RickK deleted "Puyo Pop" (content was: 'cool== Headline text ==cool== Headline text ==to win puyo pop type ----<nowiki>Insert non-formatted text here</nowiki><math>Insert formula here...')
- 06:15, 4 Jun 2004 Cyrius deleted "MediaWiki:VfD-Debate Devils beatin his wife" (unneeded VfD redirect)
- 06:13, 4 Jun 2004 Cyrius deleted "Shane Cooper" (VfD - consensus to delete)
- 06:11, 4 Jun 2004 Cyrius deleted "Electric blues euphoria" (VfD - consensus to delete)
- 06:09, 4 Jun 2004 Cyrius deleted "Peter Wagner" (VfD - consensus to delete)
- 05:42, Jun 4, 2004 RickK deleted "User talk:RíckK" (content was: 'This is the talk page of a user attempting to impersonate [[User:RickK]].')
- 05:39, Jun 4, 2004 RickK deleted "User:RíckK" (not me)
- 05:28, 4 Jun 2004 Infrogmation deleted "Affirmation (album)" (substub; no usefull info not in what links here. content was: ''''Affirmation''', released in [[1999]], was [[Savage Garden]]'s last album.{(stub)}')
- 05:27, 4 Jun 2004 Infrogmation deleted "Sam(Totally Spies)" (content was: '{(cleanup)}Sam was a member of WOOHP on Totally Spies.')
- 05:26, 4 Jun 2004 Infrogmation deleted "Natasha Henstridge" (content was: 'Actress Natasha Henstridge stars in Species and Species II.')
- 05:26, 4 Jun 2004 Infrogmation deleted "Species II" (content was: 'The 1998 film Species II stars Natasha Henstridge, Michael Madsen andMarg Helgenberger.')
- 05:25, 4 Jun 2004 Infrogmation deleted "Leslie Mann" (content was: 'Actress Leslie Mann stars in movies such as George of the Jungle and BigDaddy.')
- 05:25, 4 Jun 2004 Infrogmation deleted "Bilbeis" (unhelpful sub-stub; content was: 'Ancient fortress city in Egypt.{(stub)}')
- 05:18, 4 Jun 2004 Infrogmation deleted "Bycycle brake systems" (content was: 'Seadorff is da BOMB !!!!!! And Tim dribbles like him. GO TIM')
- 04:32, 4 Jun 2004 UtherSRG deleted "Category:Orphaned catgegories" (content was: 'stupid typo')
- 04:31, 4 Jun 2004 Guanaco deleted "User:Wik/Talk/Wik" (content was: '.')
- 04:32, 4 Jun 2004 Guanaco deleted "User talk:User talk:Wik" (content was: '.')
- 04:31, 4 Jun 2004 Guanaco deleted "User talk:Wik/Talk/Wik" (content was: '.')
- 04:31, 4 Jun 2004 Guanaco deleted "User:Wik/temp" (content was: '.')
- 04:28, 4 Jun 2004 Guanaco deleted "Thoroughly Modern Millie" (content was: 'It's a play.')
- 04:19, 4 Jun 2004 Hadal deleted "Jess McMahon" (content was: 'WWE RULZ thanks jess for starting such an empire')
- 04:16, 4 Jun 2004 John Kenney deleted "Léon Bourgeois" (content was: '#REDIRECT [[Leon Bourgeois]]')
- 03:54, 4 Jun 2004 Hadal deleted "Myles toomey" (content was: '{(delete)}Myles Toomey (1971 - present)Lives Sydney Australia')
- 03:51, 4 Jun 2004 Hadal deleted "Myles toomey" (content was: 'Myles Toomey (1971 - present)Lives Sydney Australia')
- 03:35, Jun 4, 2004 Dori deleted "Talk:Unicellular organism" (content was: '[[Image:Example.jpg]]== Headline text ==[http://www.example.com link title][[Link title]]''Italic text'''''Bold text'''[[Image:Example.jpg]]<math>In...')
- 03:33, 4 Jun 2004 Hadal deleted "Leopold kohr" (duplicate of copyvio [[Leopold Kohr]])
- 03:18, 4 Jun 2004 Hadal deleted "Cheikha Remitti el Reliziana" (content was: '{(delete)}chekha remitti el RELIZANIA')
- 03:13, Jun 4, 2004 Flockmeal deleted "Logical errors" (content was: 'least cadice doesnt date someone for less than a day')
- 03:01, 4 Jun 2004 Hadal deleted "Who the hell edited my comment on this thing?? not cool at all >: (" (content was: 'kat in the grass<nowiki>Insert non-formatted text here</nowiki>')
- 02:45, 4 Jun 2004 Hadal deleted "Prevue Channel" (content was: 'Prevue Channel was originally titled TV Guide Channel.')
- 02:29, 4 Jun 2004 Maximus Rex deleted "Spy vs. Spy" (content was: '{(cleanup)}Spy vs. Spy was an episode of Totally Spies.')
- 02:27, 4 Jun 2004 Hadal deleted "World War II German fighter aircraft" (requested by author; content before blanking was: '[[Category:World War II fighter aircraft]][[Category:World War II German aircraft]]')
- 02:27, 4 Jun 2004 Hadal deleted "World War II British fighter aircraft" (requested by author; content before blanking was: '[[Category:World War II British aircraft]][[Category:World War II fighter aircraft]]')
- 02:22, 4 Jun 2004 Danny deleted "Preying Mantis" (content was: ''''Preying Mantis'''==External Links==*[http://www.mantisuk.com/variety/wonderingviolinmantis.asp Wondering Violin Mantis - Gongylus Gongyloids]...')
- 02:21, 4 Jun 2004 Maximus Rex deleted "Image:Carte 25communes.jpg" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 02:21, 4 Jun 2004 Maximus Rex deleted "Image:LeCapitole.jpg" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 02:21, 4 Jun 2004 Maximus Rex deleted "Image:357-FACAD CAPITOLE.jpg" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 02:21, 4 Jun 2004 Maximus Rex deleted "Image:Diaporama 013 jpg.jpg" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 02:21, 4 Jun 2004 Maximus Rex deleted "Image:Jacobins.jpg" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:58, 4 Jun 2004 Maximus Rex deleted "TAC House" (content was: '{(delete)}')
- 01:54, 4 Jun 2004 Hadal deleted "Andre Cymone" (content was: ''''Bold text'''blah blah blah')
- 01:50, 4 Jun 2004 Maximus Rex deleted "Image:Brad pitt.gif" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:44, 4 Jun 2004 Maximus Rex deleted "Eliyahu Rips/temp" (content was: '#REDIRECT [[Eliyahu Rips]]')
- 01:43, 4 Jun 2004 Maximus Rex deleted "Eliyahu Rips" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:42, Jun 4, 2004 Ugen64 deleted "Siddha" (content was: 'Siddha Yogahttp://www.siddhayoga.org/index.html{(msg:delete)}')
- 01:34, 4 Jun 2004 Maximus Rex deleted "Jim Colclough/Temp" (content was: '#REDIRECT [[Jim Colclough]]')
- 01:33, 4 Jun 2004 Maximus Rex deleted "Jim Colclough" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:33, 4 Jun 2004 Maximus Rex deleted "Lam Dong province" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:33, 4 Jun 2004 Maximus Rex deleted "Propylon" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:27, 4 Jun 2004 UtherSRG deleted "Peter Fitzwilliam" (content was: '{(msg:delete)}he was a jerk.')
- 01:27, 4 Jun 2004 Maximus Rex deleted "Yen Lo Wang" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:27, 4 Jun 2004 Maximus Rex deleted "Civic Day" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:27, 4 Jun 2004 Maximus Rex deleted "Beeanatomy" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:27, 4 Jun 2004 Maximus Rex deleted "Bible Minimalism" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:26, 4 Jun 2004 Maximus Rex deleted "Indian Election 2004" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:26, 4 Jun 2004 UtherSRG deleted "Category:Sports Leagues" (content was: '#REDIRECT [[:Category:Sports leagues]]')
- 01:08, 4 Jun 2004 Maximus Rex deleted "Alliance & Leicester" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:06, 4 Jun 2004 Maximus Rex deleted "BT Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:04, 4 Jun 2004 Maximus Rex deleted "Hilton Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:02, 4 Jun 2004 Maximus Rex deleted "GUS plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:02, 4 Jun 2004 Maximus Rex deleted "Gallaher Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:02, 4 Jun 2004 Maximus Rex deleted "Exel plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:02, 4 Jun 2004 Maximus Rex deleted "Diageo plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:02, 4 Jun 2004 Maximus Rex deleted "Dixons Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:02, 4 Jun 2004 Maximus Rex deleted "Emap plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:02, 4 Jun 2004 Maximus Rex deleted "Hanson plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:02, 4 Jun 2004 Maximus Rex deleted "InterContinental Hotels Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:02, 4 Jun 2004 Maximus Rex deleted "Hays plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:00, 4 Jun 2004 Maximus Rex deleted "Land Securities Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:00, 4 Jun 2004 Maximus Rex deleted "Legal & General Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:00, 4 Jun 2004 Maximus Rex deleted "Liberty International plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:00, 4 Jun 2004 Maximus Rex deleted "Lloyds TSB Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:00, 4 Jun 2004 Maximus Rex deleted "Johnson Matthey plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:00, 4 Jun 2004 Maximus Rex deleted "Man Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:00, 4 Jun 2004 Maximus Rex deleted "Enterprise Inns plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:59, 4 Jun 2004 Maximus Rex deleted "Alliance Unichem" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:59, 4 Jun 2004 Maximus Rex deleted "British American Tobacco plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:59, 4 Jun 2004 Maximus Rex deleted "Bradford & Bingley plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 01:00, 4 Jun 2004 Maximus Rex deleted "3i Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:59, 4 Jun 2004 Maximus Rex deleted "Abbey National plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "British Land Co plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "Cable & Wireless plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "Bunzl plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "Cadbury Schweppes plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "Centrica plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "Compass Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "Daily Mail & General Trust plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "Amvescap plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "Anglo American plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:58, 4 Jun 2004 Maximus Rex deleted "Associated British Foods plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:57, 4 Jun 2004 Maximus Rex deleted "Antofagasta plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:57, 4 Jun 2004 Maximus Rex deleted "AstraZeneca plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:57, 4 Jun 2004 Maximus Rex deleted "BAE Systems plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:57, 4 Jun 2004 Maximus Rex deleted "Barclays plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:57, 4 Jun 2004 Maximus Rex deleted "BHP Billiton plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:57, 4 Jun 2004 Maximus Rex deleted "BOC Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:57, 4 Jun 2004 Maximus Rex deleted "Boots Group plc" (listed on Wikipedia:Copyright problems for over 7 days, no opposition to deletion)
- 00:38, Jun 4, 2004 Merovingian deleted "Mesogog" (content was: '{(msg:delete)}Mesogog is a mutant dino freak. But he is really the rich, slick Dr. Anton Mercer who at one time worked with the Power Ranger Tommy O...')
- 00:37, Jun 4, 2004 Merovingian deleted "Michael Meltchenko" (content was: '{(msg:delete)}He was and is, indeed, one of the best breakdancer that rule the dance floor, his moves, his style, were all amazing and beautiful to ...')
- 00:37, Jun 4, 2004 Merovingian deleted "Trapper Keeper" (speedydelete)
- 00:37, Jun 4, 2004 Merovingian deleted "Category:Baseball Hall of Famers" (content was: '{(msg:delete)}')
- 00:11, 4 Jun 2004 Roozbeh deleted "Bojnourd" (content was: '#REDIRECT [[Talk:Khorasan]]')
- 00:11, 4 Jun 2004 Mikkalai deleted "Calculation problem" (wrong def content was: 'The '''Calculation problem''' occurs when the calculations of a [[command economy]] are inaccurate.{(stub)}')
- 23:49, 3 Jun 2004 Guanaco deleted "Mutant Carrot" (content was: '{(msg:delete)}')
- 23:48, 3 Jun 2004 Guanaco deleted "Launch" (content was: '{(msg:delete)}')
- 23:47, 3 Jun 2004 Guanaco deleted "George Tankov" (content was: 'The black helicopters are on their way to your home.{(msg:delete)}')
- 23:47, 3 Jun 2004 Guanaco deleted "Xuddur" (nonsense)
- 23:31, 3 Jun 2004 G-Man deleted "Cheltenham" (making way for move)
- 23:25, Jun 3, 2004 Merovingian deleted "Basketball at the 1988 Summer Olympics" (content was: '{(msg:delete)}== Headline text ==<nowiki>Insert non-formatted text here</nowiki>[[Image:Example.jpg]][http://www.example.com link title][[Link title...')
- 23:25, Jun 3, 2004 Merovingian deleted "Weaverpedia" (content was: '{(msg:delete)}'''Weaverpedia'''Welcome to the Weaverpedia, my little storage place on the web.My current articles include:[[Waterborough, New...')
- 23:18, 3 Jun 2004 Guanaco deleted "Category:Japanese airports" (content was: 'See [[List of airports in Japan]] for a sorted list.')
- 23:18, 3 Jun 2004 Guanaco deleted "Category:Canadian Airports" (content before blanking was: '[[Category:Airports]]')
- 23:14, 3 Jun 2004 Maximus Rex deleted "Kat" (content was: '{(msg:delete)}kat is a wonderful girl who grew up in Poland, moved to California... and then moved back to Poland. I dont know why she did that and ...')
- 23:07, 3 Jun 2004 Maximus Rex deleted "Rainbow Lupin" (content was: '{(msg:delete)}')
- 22:46, 3 Jun 2004 Maximus Rex deleted "Rafn Sigurbjörnsson" (content was: '{(cleanup)}* [http://www.islandsmyndir.is/html_skjol/um_okkur/forsida.htm About Rafn]')
- 22:40, Jun 3, 2004 Merovingian deleted "Franciscus Linus" (content was: '{(msg:delete)}iugiuliuliuliuuigliugiug')
- 22:39, Jun 3, 2004 Merovingian deleted "Andrew Stehney" (content was: 'Sucks like girly men.{(msg:delete)}')
- 22:39, Jun 3, 2004 Merovingian deleted "Hapad-Lloyd Express" (content was: 'REDIRECT [[Hapag-Lloyd Express]]{(delete)}')
- 22:36, 3 Jun 2004 Maximus Rex deleted "Timwi" (content was: '#REDIRECT [[User:Timwi]]')
- 22:29, 3 Jun 2004 Angela deleted "Bleach" (temp del for page move)
- 22:27, 3 Jun 2004 Dysprosia deleted "Category:Math" (content was: '#REDIRECT [[Category:Mathematics]]')
- 22:18, 3 Jun 2004 UtherSRG deleted "MOS Technologies 8563"
- 22:17, 3 Jun 2004 UtherSRG deleted "A Stoning In Fulham County"
- 22:16, 3 Jun 2004 UtherSRG deleted "The Man Without a Face" (content was: '{(delete)}''The man without a face'' was one of the most compassionate movie i saw during my childhood. i could relate to what he was feeling, havin...')
- 22:16, 3 Jun 2004 UtherSRG deleted "Psycho-Kinesiology" (content was: ''''Psycho-Kinesiology''' In the USA, the German Dr. Dietrich Klinghardt M.D. developed Psycho-Kinesiology, an integrated method, from the basis of Ki...')
- 22:15, 3 Jun 2004 UtherSRG deleted "Kinemantra"
- 22:14, 3 Jun 2004 Francs2000 deleted "Little Chicago" (content was: 'is this ture')
- 22:13, 3 Jun 2004 UtherSRG deleted "Theory of the Firm"
- 22:13, 3 Jun 2004 Guanaco deleted "Category:Sport by country" (content was: 'Articles relating to the [[sport]] life in specific [[country|countries]].[[Category:Sports]]')
- 22:10, 3 Jun 2004 Guanaco deleted "Category:Sport" (content was: 'This is a categorisation of articles into those about [[sports]].[[Category:Games]]')
- 22:08, 3 Jun 2004 Texture deleted "B.J. Fogg" (content was: 'B.J. Fogg is the world's foremost expert on captology. http://www.bjfogg.com/')
- 22:08, 3 Jun 2004 UtherSRG deleted "User:Felix F. Bruyns" (content was: '{(vfd)}{(delete)}I cannot find a way to remove my user page or resign as a member of Wikipedia, but I no longer consider myself a member of this s...')
- 22:08, 3 Jun 2004 UtherSRG deleted "User talk:Felix F. Bruyns" (user request deletion)
- 22:05, 3 Jun 2004 Texture deleted "National 12 (dinghy" (content was: '#REDIRECT [[National 12 (dinghy)]]')
- 22:05, 3 Jun 2004 Guanaco deleted "Category:Racket sports" (content was: 'Articles about [[sport]]s whose participants use [[racket]]s.[[Category:Sport]]')
- 22:02, 3 Jun 2004 Guanaco deleted "Category:Athletics" (content was: '[[Category:Sport]]')
- 21:56, 3 Jun 2004 Texture deleted "George Roletter" (content was: 'Executive Director of Production and Technology at American Online's StudioAOL division.')
- 21:53, 3 Jun 2004 Texture deleted "Black bee position" (content was: 'hi')
- 21:50, 3 Jun 2004 Texture deleted "Kensington Runestone" (user test)
- 21:48, 3 Jun 2004 Texture deleted "See www.lds.org" (content was: '[http://www.lds.org]')
- 21:24, 3 Jun 2004 Wile E. Heresiarch deleted "Template:Top seeds for French Open 2004" (consensus to delete on vfd)
- 21:10, 3 Jun 2004 Texture deleted "Reading log" (content was: '[[Link title]]adsdsadsasadassaasddsa')
- 20:58, 3 Jun 2004 Guanaco deleted "Image:Simplified pulsejet1a.bmp" (exact duplicate of much smaller PNG)
- 20:57, 3 Jun 2004 Guanaco deleted "Image:Map of Oz.bmp" (exact duplicate of much smaller PNG)
- 20:54, 3 Jun 2004 Guanaco deleted "Image:Leather scales plans.bmp" (exact duplicate of much smaller PNG)
- 20:52, 3 Jun 2004 Francs2000 deleted "Cummins Engine" (content was: '[[Link title]]== Headline text ==[[Image:Example.jpg]][[Media:Example.ogg]]<math>Insert formula here</math>--[[User:24.9.164.138|24.9.164.138]] 20:4...')
- 20:50, 3 Jun 2004 Francs2000 deleted "Dead or Alive: Extreme Beach Volleyball" (content was: '{(msg:delete)}why is this so stupid?')
- 20:48, 3 Jun 2004 Texture deleted "Justin Butler" (content was: 'He's real cool and sometimes contributes to this site.^_^')
- 20:47, 3 Jun 2004 SimonP deleted "Pan German" (content was: ''''its all about the woo-tang clan'''')
- 20:41, 3 Jun 2004 Guanaco deleted "Image:Redhead23.jpg" (accidental upload, exact duplicate)
- 20:41, 3 Jun 2004 Texture deleted "Talk:Leet for a rundown" (content was: '[[Link title]][[Image:Example.jpg]]'''Bold text'''lalalalala')
- 20:29, 3 Jun 2004 Texture restored "E.T.O.S."
- 20:28, 3 Jun 2004 Texture restored "ETOS"
- 20:28, 3 Jun 2004 Guanaco deleted "Morava" (disambig w/ 2 broken links)
- 20:19, 3 Jun 2004 Texture deleted "E.T.O.S." (content was: '#REDIRECT [[Eternal Tears of Sorrow]]')
- 20:19, 3 Jun 2004 Texture deleted "ETOS" (content was: '#REDIRECT [[Eternal Tears of Sorrow]]')
- 20:10, 3 Jun 2004 Francs2000 deleted "Oliver" (content before blanking was: 'This stupid person is called Oliver Czernik !')
- 20:08, 3 Jun 2004 Ahoerstemeier deleted "Alphazone" (content was: '{(speedy)}Project started by Kalle Moodh and Fredrik Wärnsberg, more information Later!#alphazone @ quakenet')
- 20:07, 3 Jun 2004 Ahoerstemeier deleted "Hard money" (content was: 'jdngdngd{(delete)}')
- 20:07, 3 Jun 2004 Francs2000 deleted "Alphazone" (content was: 'Project started by Kalle Moodh and Fredrik Wärnsberg, more information Later!#alphazone @ quakenet')
- 19:55, 3 Jun 2004 DavidWBrooks deleted "The First Evil"
- 19:45, 3 Jun 2004 Francs2000 deleted "Redbone Coonhound" (content was: '{(msg:delete)}I like great danes MORE!!!!! You should get one, they are loyal and helpful.')
- 19:45, 3 Jun 2004 Angela deleted "Talk:Test page" (test finished)
- 19:45, 3 Jun 2004 Francs2000 deleted "Smart Ask" (content was: ''''''Nobu rocks my world!'''''{(delete)}')
- 19:45, 3 Jun 2004 Angela deleted "Red and Blue" (test finished)
- 19:45, 3 Jun 2004 Angela deleted "Test page" (test finished)
- 19:41, 3 Jun 2004 Francs2000 deleted "LUEshi" (nonsense)
- 19:40, 3 Jun 2004 Guanaco deleted "Wikipedia:Sandbox" (clearing old garbage -- recreating w/ just a sandbox header)
- 19:37, 3 Jun 2004 Francs2000 deleted "Allergic asthma" (content was: '{(msg:delete)}Asthma that is allergic. DUH! [http://www.penny-arcade.com Abu Bakr Mohammad Ibn Zakariya al-Razi]')
- 19:36, 3 Jun 2004 Francs2000 deleted "Phubuh" (content was: 'See [[happyfish]]. Different people but exactly the same methods and end result.{(delete)}')
- 19:33, 3 Jun 2004 Francs2000 deleted "Marco Neumann" (content was: 'Marco NeumannInformation Science')
- 19:33, 3 Jun 2004 Francs2000 deleted "Politecnico di Milano" (content was: 'cghxcgb')
- 19:27, 3 Jun 2004 Francs2000 deleted "Tamara McKinney" (content before blanking was: 'FUCK U ALL FUCK U ALL!')
- 19:24, 3 Jun 2004 Stan Shebs deleted "Happyfish" (content was: '{(msg:delete)}[[Something Awful|SA]] forums troll. Posted technically correct but often offensive responses to idiocy. Was eventually permabanned af...')
- 19:20, 3 Jun 2004 Francs2000 deleted "FuXi" (content was: 'Fuxi is an ancient hero/leader that was common in Chinese mythology!!')
- 19:16, 3 Jun 2004 Francs2000 deleted "Honda FCX" (content was: 'http://www.hondacorporate.com/fcx/')
- 19:16, 3 Jun 2004 Francs2000 deleted "1951 in art" (blanked by author)
- 19:06, 3 Jun 2004 Guanaco deleted "Mechanical filters" (content was: '{(msg:delete)}'''Bold text'''== Headline text ==<nowiki>Insert non-formatted text here</nowiki><math>Insert formula here</math>----[[Media:Examp...')
- 19:06, 3 Jun 2004 Guanaco deleted "Tantan" (content was: '{(msg:delete)}Tantan is a computer engineer who smells glue and is totally idle, just waiting to come back home')
- 19:04, 3 Jun 2004 Guanaco deleted "Wappen" (content was: '{(msg:delete)}[[http://www.soltau.de/images/top/logo2.gif]]')
- 19:04, 3 Jun 2004 Guanaco deleted "Irish giant deer" (content was: '{(msg:delete)}I'm an Irish giant deer.. I'm not extinct...it should be giant Irish deer, it just SOUNDS better . . .')
- 19:03, 3 Jun 2004 Guanaco deleted "Religious Persecution in China" (religious spam/nonsense w/ no factual information)
- 18:59, 3 Jun 2004 Guanaco deleted "Boulevard Bou" (newbie test)
- 18:55, 3 Jun 2004 Guanaco deleted "Shrek2" (content was: '{(msg:delete)} Eddy Murphy stars again in Shrek 2. In this sequel of Shrek the married couple get a message from princess Veonoa's Paren...')
- 18:50, 3 Jun 2004 Guanaco deleted "Image:Maine Coon in Daylilies.JPG" (reuploading my image with lowercase extension)
- 18:46, 3 Jun 2004 UtherSRG deleted "Template:Table Moods" (content was: '{(delete)}{| align='right' id='toc' style='margin-left: 15px;'|align=center bgcolor=#ccccff| '''Moods'''|-| [[Indicative mood]]|-| [[Imperative...')
- 18:45, 3 Jun 2004 UtherSRG deleted "MediaWiki:Table Moods" (content was: '#redirect [[Template:Table Moods]]')
- 18:39, 3 Jun 2004 DavidWBrooks deleted "Religious Persection in China" (screed)
- 18:28, 3 Jun 2004 DavidWBrooks deleted "Jean Duceppe" (content was: '{(msg:delete)}== Headline text ==zfgng')
- 18:26, 3 Jun 2004 Ahoerstemeier deleted "MorchiuS" (content was: '{(msg:delete)}'''X'''[[z]] Really Rulez >))')
- 18:25, 3 Jun 2004 Guanaco deleted "Bganesh" (broken redirect)
- 18:22, 3 Jun 2004 Guanaco restored "Zoe_Falkenberg"
- 18:22, 3 Jun 2004 Guanaco deleted "Zoe Falkenberg" (broken redirect)
- 18:17, 3 Jun 2004 Maximus Rex deleted "The Golden Age Of Grotesque" (content was: '{(msg:delete)}selam piç kusuru ananı sikiyim ben senınpiç')
- 18:15, 3 Jun 2004 Sannse deleted "Image:Zonkey 800.jpg" (replaced by Image:Zeedonk 800.jpg)
- 17:41, 3 Jun 2004 Ahoerstemeier deleted "Wata do if oil spills" (content was: 'dffhegejgtf6sdhre rr sadhesdthdr etthewku trrhe srueew jrhsdrjksrrr sdjrseruer tge sjrusejsl jka')
- 17:40, 3 Jun 2004 Maximus Rex deleted "Society of Biblical Literature" (content was: 'hostory of bibble from the begining to end')
- 17:35, 3 Jun 2004 Maximus Rex deleted "Photophosphorylation" (content was: 'noogie')
- 17:10, 3 Jun 2004 Ahoerstemeier deleted "Mahavairocana Sutra" (content was: '''Italic text''== Headline text ==<nowiki>Insert non-formatted text here</nowiki>----')
- 16:55, 3 Jun 2004 Jimfbleak deleted "Germanophobia" (dic def content was: 'Irrational, abnormal and persistent fear of Germany, German people or German culture.{(stub)}')
- 16:54, 3 Jun 2004 Jimfbleak deleted "Harry L. O'Connor" (content was: 'While filming the film XXX (2002), was killed because he struck a pillar of a bridge while being pulled on a paraglider.{(delete)}')
- 16:52, 3 Jun 2004 Jimfbleak deleted "Flash Games" (content was: '* [[City Jumper]]{(delete)}')
- 16:52, 3 Jun 2004 Jimfbleak deleted "Nicky Larson" (content was: 'Nicky Larson is the french name of Ryô Saeba, in the japonese manga [[City Hunter]].{(delete)}')
- 16:51, 3 Jun 2004 Jimfbleak deleted "Shrek2" (unintelligible content was: 'In this sequel of Shrek the married couple get a message from princess Veonoa's Parents inviting them to the castle. While they are there Veonoa's Fai...')
- 16:50, 3 Jun 2004 Jimfbleak deleted "Dr. Dolittle 2" (content was: 'gerhniugbsdi8ufgasdopijnifiuzxvggbdfhgdfhgdbdsfbvxcbxcb')
- 16:34, 3 Jun 2004 Jamesday restored "Reinhard_Hauff"
- 16:32, 3 Jun 2004 Ahoerstemeier deleted "No. 679 Squadron RAF" (content was: 'Looking for info on an 'N. Riley' that flew with 679 Squadron, in 1943-44. Anything would be helpful!')
- 16:29, 3 Jun 2004 Ahoerstemeier deleted "Zeisel number" (content was: '{(msg:delete)}This is a page I just got to and stuff..')
- 16:28, 3 Jun 2004 Ahoerstemeier deleted "Kew Gardens, Queens" (content was: 'external link : http://www.oldkewgardens.com/')
- 16:28, 3 Jun 2004 Ahoerstemeier deleted "Big Tymers" (content was: ''''Bold text''' if you were still who would you be with')
- 16:27, 3 Jun 2004 Ahoerstemeier deleted "Desenrascanço" (content was: 'calão do verbo desenrascar, safar, em alternativa')
- 16:12, Jun 3, 2004 Raul654 deleted "Wikipolice" (content was: '#REDIRECT [[Wikipedia:Wikipolice]]')
- 16:01, 3 Jun 2004 DavidWBrooks deleted "Julia Levy" (content was: 'hello your my favorite hero I love you')
- 16:01, 3 Jun 2004 DavidWBrooks deleted "Boxers" (content was: 'grrr grrr grr ok shure why not')
- 15:52, 3 Jun 2004 Ahoerstemeier deleted "Maurice de Vlaminck" (content was: 'I love Maurice. He's always sweet when I visit him. Hi. STEPH!')
- 15:52, 3 Jun 2004 Ahoerstemeier deleted "Modern Style" (content before blanking was: 'HOLLA AT YA BABY')
- 15:52, 3 Jun 2004 Ahoerstemeier deleted "Popular revolt" (content was: 'big ol' fuckin mistake')
- 15:51, 3 Jun 2004 Ahoerstemeier deleted "Cold-water fish" (content was: 'Konichiwa')
- 15:51, 3 Jun 2004 Ahoerstemeier deleted "Kompong Thom" (content was: '--[[User:204.169.23.246|204.169.23.246]] 15:50, 3 Jun 2004 (UTC)<math>y=x^2[[Image:Example.jpg]]</math>')
- 15:47, 3 Jun 2004 Texture deleted "Category on Alternative Medicine" (content was: '{(delete)}')
- 15:48, 3 Jun 2004 Texture deleted "Talk:Category on Alternative Medicine" (content before blanking was: '{(CamRequiredNotice)}This article is a mirror of <nowiki>[[Category:Alternative medicine]]</nowiki> and is a required part of the [[Wikipedia:Wikipr...')
- 15:42, 3 Jun 2004 DavidWBrooks deleted "Philips Arena" (content was: 'YO')
- 15:17, Jun 3, 2004 Dori deleted "Talk:Karl Lagerfeld" (content was: ''''Bold text'''how old is he?[http://www.example.com link title]== Headline text ==[[Image:Example.jpg]][[Media:Example.mp3]]<math>Insert formula h...')
- 15:17, Jun 3, 2004 Dori deleted "Froggatt Edge" (content was: 'froggart wank'''Bold text''''''thid is boldnnoow''' [[Image:Example.jpg]] [[Image:Example.jpg]] [[Image:Example.jpg]] --[[User:213.120.90.5...')
- 15:16, 3 Jun 2004 Ahoerstemeier deleted "Differentiator" (content was: 'dcvifgu oifgoer0gj l;qk fg;oer golqiwej folqwe ioqhjwe oi hjwo lfijq eriltohj epoighjq er ;o'tkqjer;o tiqer;iogt')
- 15:12, 3 Jun 2004 Sverdrup deleted "Template:Has been on vfd" (empty, never used; content was: '#REDIRECT [[MediaWiki:Past-vfd]]')
- 15:11, 3 Jun 2004 Sverdrup deleted "MediaWiki:Has been on vfd" (empty, never used; content was: '#redirect [[Template:Has been on vfd]]')
- 15:01, 3 Jun 2004 UtherSRG deleted "EnterpriseCM, Inc. Enterprise Change Management and Technology Consulting www.EnterpriseCM.com" (content was: '{(delete)}[http://www.enterprisecm.com EnterpriseCM, Inc.]provides management and technology consulting services to a global customer base.')
- 14:59, 3 Jun 2004 DavidWBrooks deleted "Ecological rucksack" (page was empty)
- 14:47, 3 Jun 2004 DavidWBrooks deleted "Patrick Battiston" (content was: ''''Bold text'''ANAL')
- 14:40, 3 Jun 2004 Zanimum deleted "Eurocopter AS 355F-1 Twin Squirrel" (content was: 'hi')
- 14:35, 3 Jun 2004 Ahoerstemeier deleted "William 'Wullie'" (content was: ''''Bold text''' oor wullie is the best')
- 14:35, 3 Jun 2004 Ahoerstemeier deleted "Weeble and Bob" (content was: '(tekst hier) Zho.')
- 14:34, 3 Jun 2004 Ahoerstemeier deleted "STAVROS" (content was: 'Stav was here')
- 14:32, 3 Jun 2004 DavidWBrooks deleted "Syntax diagram" (content before blanking was: ''''old macdonald had a farm.. ia ia oh'''Bold text''''''')
- 14:30, 3 Jun 2004 DavidWBrooks deleted "Pulaski Academy" (content was: '== Hell on Earth ==')
- 14:24, 3 Jun 2004 Chris 73 deleted "Antony K Philip" (content was: '{(msg:delete)}Man from cochin, padivattom created great artistic and classical films with great wit and sharp criticism over the social and communal...')
- 13:50, 3 Jun 2004 Pcb21 deleted "Grandfather's brother paradox" (still as fake as the last time vfd voted to delete this)
- 13:31, 3 Jun 2004 Ahoerstemeier deleted "Mario (Nintendo character" (content was: 'I LIKE PIE OMFG OMFG OMFG')
- 13:02, 3 Jun 2004 Hemanshu deleted "Diego Simeone" (content was: '== Headline text ==David beckham is the best football player in history hge has won both Manchester United and Real Madrid Some great games he is th...')
- 12:12, 3 Jun 2004 Hemanshu deleted "Talk:1940 Summer Olympics" (content was: 'the olumpics are held every 4 years.by kieren')
- 11:59, 3 Jun 2004 Sverdrup deleted "Les paradis artificiels" (content was: '{(delete)}By Charles BaudelaireAbout the trance under influence of alcohol and opium.')
- 11:54, 3 Jun 2004 Francs2000 deleted "Nicky Larson" (content was: ''Nicky Larson' is the french name of the japonese manga and cartoon [[City Hunter]].{(delete)}')
- 11:28, 3 Jun 2004 Ahoerstemeier deleted "Rotodyne" (content was: ' was <nowiki>#redirect </nowiki>[[fairey_rotodyne]]{(delete)}(non existing redir)')
- 11:19, 3 Jun 2004 UtherSRG deleted "Category:Children's writer" (content before blanking was: '[[Category:Writers by genre]]')
- 11:12, 3 Jun 2004 UtherSRG deleted "Category:ZOPE" (content before blanking was: '[[Category: Content management systems]] [[Category: Free software]]')
- 11:11, 3 Jun 2004 UtherSRG deleted "Category:Australian musicial groups" (content before blanking was: '[[Category:Australian music]]')
- 10:59, 3 Jun 2004 Francs2000 deleted "Hauri" (content was: '== Headline text ==')
- 10:58, 3 Jun 2004 Francs2000 deleted "Universität Paderborn" (content was: '[http://www.upb.de University of Paderborn homepage]')
- 10:42, Jun 3, 2004 Jmabel deleted "Devil's Tail" (content was: 'devils tail1 shot of rum1 shot of gold rum 1 ice block1 shot of wild bull2 shots of iner circel rum 1 tea spoon of red cordeal3 shots of tekela...')
- 10:17, Jun 3, 2004 Jmabel deleted "Hard-boiled detective novel" (content was: 'i don't know hard-boiled detective novels, but i loooooooooove hard-boiled eggs... mmmmmm.... ok i'm going to lunch now... EGGS!!!!!!!!!!!!!!!!!!!!!!!...')
- 10:17, Jun 3, 2004 Jmabel deleted "Play It Again, Sam" (content was: 'Yeah Sam!!!!!!!!!!! play it again!!!!!!!!!!!!!!!!!')
- 09:12, 3 Jun 2004 Francs2000 deleted "List of Australian Post Codes" (content was: '{(delete)}[http://www.auspost.com.au/postcodes/ Australia Post]')
- 09:10, 3 Jun 2004 Francs2000 deleted "Jay Hill" (content was: '{(delete)}Shit')
- 08:40, 3 Jun 2004 Maximus Rex deleted "Proxy firewall" (content was: '{(delete)}grftgdfgtffdjfgv fgj fhshgdf shgfshf hgfhs fhf sgfhs fshgshgfghsfg ghsf sfg jgf suy uewuwtyrg urtwiuer twiuiw i fjs fnvbnmvbnxvnv j v vx nv')
- 08:38, 3 Jun 2004 Maximus Rex deleted "A Big Day For Thomas" (content was: '{(delete)}s;j')
- 08:34, 3 Jun 2004 Maximus Rex deleted "Transwiki:Zazaki" (previously deleted copyvio has come back (again))
- 08:22, 3 Jun 2004 Maximus Rex deleted "Gary the Rat" (content was: '{(cleanup)}based on a web cartoon.')
- 08:22, 3 Jun 2004 Maximus Rex deleted "Bok" (content was: '{(delete)}')
- 08:20, 3 Jun 2004 Jmabel deleted "Mr. Green" (content was: '{(delete)}hl')
- 08:20, 3 Jun 2004 Maximus Rex deleted "Artificail insemination" (content was: '{(delete)}This page is horny')
- 08:11, 3 Jun 2004 Jmabel restored "Antony_K_Philip"
- 08:09, 3 Jun 2004 Jmabel deleted "Antony K Philip" (content was: '{(delete)}--[[User:61.11.47.200|61.11.47.200]] 05:51, 3 Jun 2004 (UTC)aNTONY')
- 08:08, 3 Jun 2004 Jmabel deleted "Mudbutt" (content was: '{(delete)}Mudbutt is the medical condition characterized by explosive diarrhea, sometimes accompanied by leakage.It was first discovered by Dr. Dan...')
- 07:40, 3 Jun 2004 Ahoerstemeier deleted "Application level firewall" (content was: '{(delete)}ftwergtergerg rghtr rygr uiuyutyutyutuhfhfgh fhg dgedrf')
- 07:35, 3 Jun 2004 Maximus Rex deleted "Brian Ashby" (content was: ''''Brian Ashby''' (b. [[October 28]], [[1983]]) is one of the world's leading [[autotroph]]s. He currently resides in [[Bosnia]].{(stub)}')
- 05:44, 3 Jun 2004 Tom- deleted "HP-48SX" (content was: ''''Bold text'''345<math>Insert formula here</math>543')
- 05:35, 3 Jun 2004 Jimfbleak deleted "Ganesh Bikshandi" (content was: '{(delete)}#Redirect [[User:Vbganesh]]')
- 05:26, 3 Jun 2004 Tom- deleted "Mr. Bean Amineited Series" (Article name mispelled, no useful content)
- 05:25, 3 Jun 2004 Tom- deleted "Universiti Teknologi Malaysia" (content was: 'Ganasai University')
- 05:22, 3 Jun 2004 Infrogmation deleted "Talk:Octavio Paz" (content was: 'hey sup everyone')
- 05:11, Jun 3, 2004 TUF-KAT deleted "Runnin' (Dying to Live)" (apparently source texts, a spliced together copy of lyrics and an interview with Tupac -- whatever it is, it's nowhere's near an article)
- 04:48, 3 Jun 2004 Hadal deleted "Culture of Samoa" (content was: '{(delete)}This site isnt up yet, dangnabit i need this information...hehe kcee we lub labrador')
- 04:37, 3 Jun 2004 Hadal deleted "David Robinson (musician)" (content was: '{(msg:delete)}sdf')
- 04:24, 3 Jun 2004 Cecropia deleted "Dubes" (content was: 'No Worries')
- 04:14, 3 Jun 2004 Chris 73 deleted "My Hiding Place" (says: Copyright Nick Theodore Wong 2004)
- 04:13, 3 Jun 2004 Chris 73 deleted "The Outlaw" (content was: '--[[User:210.23.137.110|210.23.137.110]] 03:33, 3 Jun 2004 (UTC)== Headline text ==You think the Outlaw is any good? GO HOME!!!It is pathetic[[...')
- 04:12, 3 Jun 2004 Chris 73 deleted "The Academia Waltz" (content was: '''The Academia Waltz'', was [[cartoonist]] [[Berke Breathed]]'s first cartoon. He wrote it while still in college at The University of Texas Austin.')
- 04:10, 3 Jun 2004 Chris 73 deleted "Eigelstein" (content was: 'Eigelstein is the birthplace of angry marsupials.')
- 04:05, 3 Jun 2004 Chris 73 deleted "Shorter Oxford English Dictionary" (content was: '[[hi]]my name is --[[User:199.126.254.116|199.126.254.116]] 03:57, 3 Jun 2004 (UTC)sunshine, what is your == name ==?')
- 04:05, 3 Jun 2004 Chris 73 deleted "Asshole Lattes" (content was: 'A good anal drink from a stupid coffee chain.')
- 04:04, 3 Jun 2004 Chris 73 deleted "Mutant Carrot" (content was: '{(msg:delete)}Mutant Carrot is a politically driven hardcore band from Western NY. Hit songs include Die Die Die and Mutant Carrot. They are, acco...')
- 04:03, 3 Jun 2004 Chris 73 deleted "Twisted Nerve" (content was: '{(msg:delete)}Twisted Nerve was chosen for Kill Bill Volume 1,by Quentin Tarantino.')
- 04:03, 3 Jun 2004 Chris 73 deleted "Arabic classical music" (content was: '{(msg:delete)}adfhdkjhdkghkdfgjdfkl')
- 04:03, 3 Jun 2004 Chris 73 deleted "Pen-y-Darren ironworks" (content was: '[[Image:Example.jpg]]== Headline text ==[http://www.example.com link title][[Link title]]''Italic text'''''Bold text'''------[[User:67.38.160.95|6...')
- 04:03, 3 Jun 2004 Chris 73 deleted "Holidays of France" (content was: '{(msg:delete)}I dont Know :(')
- 04:02, 3 Jun 2004 Chris 73 deleted "Back in 92" (content was: '{(msg:delete)}Back in 92 is a currently defunct Western New York Punk band. They existed from 2003 to 2004. Their members have moved on to new pro...')
- 03:55, Jun 3, 2004 Jengod deleted "Wilshire Boulevard" (content was: '------[[User:24.130.208.210|24.130.208.210]] 02:43, 3 Jun 2004 (UTC)<nowiki>Insert non-formatted text here</nowiki>[[Media:Example.ogg]][[Image:Examp...')
- 03:42, 3 Jun 2004 Guanaco deleted "Beastiality" (content was: 'Sex w/ animals')
- 02:49, 3 Jun 2004 UtherSRG deleted "Marina harbor" (duplicate article with that at [[Marina]])
- 02:48, 3 Jun 2004 UtherSRG deleted "Category:Computer and Video Games" (content was: 'This category categorizes articles about [[computer game]]s and [[video game]]s.[[Category:Games]][[Category:Software]]')
- 02:47, 3 Jun 2004 UtherSRG deleted "Category:Video Games" (content was: 'This category categorizes [[video game]]s.[[Category:Arcade games]][[Category:Computer and Video Games]]')
- 02:48, 3 Jun 2004 Cyrius deleted "James Holzier" (VfD - consensus to delete)
- 02:47, 3 Jun 2004 Cyrius deleted "Talk:James Holzier" (VfD delete article's talk page with no content to speak of)
- 02:47, 3 Jun 2004 UtherSRG deleted "Category:Computer games" (content was: 'This is a category for [[computer game]]s.[[Category:Computer and Video Games]][[Category:Software]]')
- 02:45, 3 Jun 2004 UtherSRG deleted "Category:Action-adventure computer game" (content was: 'This category is for [[action adventure game]]s. (See also [[:Category:Adventure computer games]].)[[Category:Computer and video games]]')
- 02:40, 3 Jun 2004 Cyrius deleted "Image:Flag of Fifth World Council.jpg" (image associated with VfD deleted article - no reuse possibility, unacceptable copyright terms)
- 02:39, 3 Jun 2004 Cyrius deleted "Fifth World nation" (VfD - consensus to delete)
- 02:37, 3 Jun 2004 Cyrius deleted "Talk:Jus cerebri electronici" (talk page for VfD deleted article that has no information that needs archiving)
- 02:36, 3 Jun 2004 Cyrius deleted "Jus cerebri electronici" (VfD - consensus to delete)
- 02:36, 3 Jun 2004 Cyrius deleted "Law of the Server" (VfD deleted article redirect)
- 02:32, 3 Jun 2004 Cyrius deleted "MediaWiki:VfD-Polyface Farm" (unneeded VfD redirect)
- 02:31, 3 Jun 2004 Guanaco deleted "Category:Actors and actresses" (content was: 'See [[:Category:Actors]] for both male and female actors.')
- 02:30, 3 Jun 2004 Guanaco restored "Category:Actors_and_actresses"
- 02:30, 3 Jun 2004 Cyrius deleted "Cagone" (VfD - consensus to delete)
- 02:30, 3 Jun 2004 Guanaco deleted "Category:Actors and actresses" (content was: 'See [[:Category:Actors]] for both male and female actors.')
- 02:28, 3 Jun 2004 Hephaestos deleted "Katie Noonan" (content was: '[[Category:George members]]')
- 02:28, 3 Jun 2004 Cyrius deleted "Yu song" (VfD - consensus to delete)
- 02:26, 3 Jun 2004 Guanaco deleted "Category:University libraries" (content was: '[[Category:Academic libraries]][[Category:Universities]]')
- 02:25, 3 Jun 2004 Cyrius deleted "Advanet" (VfD - consensus to delete)
- 02:21, 3 Jun 2004 Guanaco deleted "Category:Abjad writing systems" (content was: '[[Category:Writing systems]]')
- 02:13, 3 Jun 2004 Guanaco deleted "Category:African Rivers" (content was: '#REDIRECT [[:Category:African rivers]]')
- 02:13, 3 Jun 2004 Michael Hardy deleted "Plum blossom" (content was: '#Redirect [[plum]]')
- 02:12, 3 Jun 2004 Guanaco deleted "Б" (newbie test)
- 02:12, 3 Jun 2004 Cyrius deleted "List of people who have not committed suicide" (VfD - consensus to delete)
- 02:05, 3 Jun 2004 Cyrius deleted "Image:Djpetzi magna10.jpg" (album cover associated with VfD deleted vanity page)
- 02:05, 3 Jun 2004 Cyrius deleted "Image:Djpetzi loop12801.jpg" (album cover associated with VfD deleted vanity page)
- 02:05, 3 Jun 2004 Cyrius deleted "Talk:DJ Petzi" (talk page for VfD deleted article)
- 02:04, 3 Jun 2004 Cyrius deleted "DJ Petzi" (VfD - consensus to delete)
- 02:02, 3 Jun 2004 Dpbsmith deleted "Debt-free, Tax-free, Indexed Fiat Money" (Removed per VfD discussion AND author's request)
- 01:58, 3 Jun 2004 Cyrius deleted "Union for Traditional Judaism" (VfD - consensus to delete)
- 01:58, 3 Jun 2004 Cyrius deleted "Netivot Shalom" (VfD - consensus to delete)
- 01:55, 3 Jun 2004 Cyrius deleted "Pink Floyd Long Songs" (VfD - consensus to delete)
- 01:50, 3 Jun 2004 Guanaco deleted "Energy technology" (just a list of links)
- 01:47, 3 Jun 2004 Cyrius deleted "Talk:Trollgnaw" (talk page for VfD delete page - no significant history)
- 01:46, 3 Jun 2004 Cyrius deleted "Trollgnaw" (VfD - consensus to delete)
- 01:40, 3 Jun 2004 Hephaestos deleted "Sarcee, Alberta" (content was: 'pooo')
- 01:20, 3 Jun 2004 Sverdrup deleted "Sars b teh ugleh" (content was: 'Sars b teh ugleh')
- 01:12, 3 Jun 2004 Sverdrup deleted "Jennie" (content was: '{(delete)}Jennie is.... hm it's too difficult to explain. Anyone have any comments?')
- 01:10, 3 Jun 2004 Maximus Rex deleted "Sator grandaevus" (content was: 'latin word for creator')
- 01:03, 3 Jun 2004 Maximus Rex deleted "Brian Ashby" (content was: 'Brian Ashby was born in [[North Carolina]] on October 28th, 1983, and is one of the leading [[autotroph]]s of the modern age. His most famous student...')
- 01:03, 3 Jun 2004 Maximus Rex deleted "Timothy Matlack" (content was: '{(msg:delete)}Matlack was born on July, 31, 1746.and he was born a retarded fat ass.')
- 00:55, 3 Jun 2004 Guanaco deleted "User:Guanaco/Sandbox" (content was: '[[Image:Respiration.gif|80px]]')
- 00:48, 3 Jun 2004 Sverdrup deleted "Aristides (horse)" (content was: 'He was evil and gay')
- 00:41, 3 Jun 2004 UtherSRG deleted "Disapproval" (content was: '{(msg:delete)}to openly condemn, disfavour or dislike.')
- 00:40, 3 Jun 2004 Sverdrup deleted "Latin alphabet/Temp" (content was: 'hey motherf'ers ya im serbian, so i no stuff, so yah. thanks. bye biotches.....F*** U!!!')
- 00:37, 3 Jun 2004 Sverdrup deleted "Exploration after 1599" (content was: 'After 1599 AD, many more greedy Europeans with powdered wigs shipped natives out of Africa to their haciendas and plantations. Everyone was sick to de...')
- 00:36, 3 Jun 2004 Sverdrup deleted "Grants" (content : " From Wikipedia, the free encyclopedia. !!!!!!!!!!!!!OBLIVION X ENTERTIANMENT AND KROOKED ELEMENT RECORDS ARE TAKING OVER THE ENTIRE RAP GAME!!!!!!!!!!!!! " etc.)
- 00:36, Jun 3, 2004 Raul654 deleted "Category:World War II guns" (content was: '(This catagory has been deprecated)')
- 00:35, 3 Jun 2004 Sverdrup deleted "Benjamin Pietravalle" (content was: 'Ben Pietravalle has never done anything to particularly distinguish himself from any other man, but as he is in fact a real, current, human existent (...')
- 00:31, 3 Jun 2004 Sverdrup deleted "Latin hypercube" (content was: 'A standard hypercube, but a little of that jungle salsa FLAIR. Arribbba!!!!')
- 00:30, 3 Jun 2004 Sverdrup deleted "Rose Falcon" (content was: '{(msg:delete)}f*cked so many G*y people')
- 00:30, 3 Jun 2004 Sverdrup deleted "Jon-Erik Hexum" (content was: '{(msg:delete)}he sucks, he's dead')
- 00:30, 3 Jun 2004 Sverdrup deleted "Don Peterson" (content was: '{(msg:delete)}A GAY GAY GAY PERSON')
- 00:30, 3 Jun 2004 Sverdrup deleted "Welsh mythology" (content was: 'welsh')
- 00:20, 3 Jun 2004 Hephaestos deleted "Foreign relations of the Soviet Union" (content was: 'all hell broke loose')
- 00:19, 3 Jun 2004 Sverdrup deleted "Finite State Machine Explorer" (content was: 'da fuck')
- 00:18, 3 Jun 2004 Sverdrup deleted "Aristides (horse)" (content was: 'I am a fag ooooh yah!')
- 00:18, 3 Jun 2004 Sverdrup deleted "Don Galloway" (content was: '[[Link title]]The Baltimore Orioles won the world series in baseball in 1983. Below is a graph of how many people got Fu*ked')
- 00:15, 3 Jun 2004 Hephaestos deleted "Benjamin Pietravalle" (BS. content was: 'Born on March 4th, 1984, in the [[Acciogaggian Mountain Region]], Benjamin Pietravalle has studied [[autotroph]]ism under the prodigious [[Brian Ashby...')
- 00:09, 3 Jun 2004 Mikkalai deleted "Taimyrs" (there is no such nationality. content was: '#REDIRECT [[Taymyria]]')
- 00:08, 3 Jun 2004 Hephaestos deleted "Benjamin Pietravalle" (content was: 'Benjamin Pietravalle was born ([[autochthonous]]ly) in the Acciogaggian highlands in the thirty first year of the reign of Orange Duluth XII. He was ...')
- 23:39, 2 Jun 2004 Guanaco deleted "Kassandra HiroshimA" (duplicate of [[Kassandra Hiroshima]])
- 23:34, 2 Jun 2004 Guanaco deleted "MediaWiki:VfD-Digivolve" (content was: '#REDIRECT [[Talk:Digivolution]]')
- 23:26, 2 Jun 2004 Guanaco deleted "Guánica Bay" (in spanish - nonsense according to 2 spanish speakers)
- 23:23, 2 Jun 2004 Hephaestos deleted "Off the mark" (content was: '{(msg:delete)}'''Off The Mark!'''The best and funniest comics I've ever seen.*http://www.offthemark.com - actual site')
- 23:21, 2 Jun 2004 Sverdrup deleted "Drinking and driving" (content was: '{(delete)}I think that Gordan Campbell shouldnt be Canada's premier. He obviously has some kind of retarded disability and noone likes him so lets g...')
- 23:20, 2 Jun 2004 Sverdrup deleted "Krinlash" (content was: 'A word used to describe anything for which a suitable real word cannot be found. Blame morris, he claims that its his word')
- 23:19, 2 Jun 2004 Sverdrup deleted "PKD FBI File" (empty page.)
- 23:15, 2 Jun 2004 Sverdrup deleted "User:195.93.34.12/message" (deleting strange page, was listed on vfd; content was: ':''This page has been listed on [[Wikipedia:Votes for deletion]]. Please see that page for justifications and discussion[[MediaWiki:Vfd|.]]''<br>'...')
- 23:13, 2 Jun 2004 Guanaco deleted "Ice-cube" (broken redir content was: '#REDIRECT [[Ice cube]]')
- 23:03, 2 Jun 2004 Sverdrup deleted "Pula (Romanian swearword)" (delete following consensus on vfd; content was: ':''This page has been listed on [[Wikipedia:Votes for deletion]]. Please see that page for justifications and discussion[[MediaWiki:Vfd|.]]''<br>I...')
- 23:02, 2 Jun 2004 Guanaco deleted "Unchr" (content was: 'United Nations Commission on Human Rights')
- 23:02, 2 Jun 2004 Guanaco deleted "U.S. Counter Intelligence Corps" (content was: 'Gay gay gay gay gay gay gay gay gay gay gay gay gay gay gay gay.')
- 23:01, 2 Jun 2004 Guanaco deleted "Normal pressure" (huh? — content was: 'Normal pressure is considered 1 atm, 760mm of Hg (torr), or 101.32501 kPa.')
- 22:56, 2 Jun 2004 Guanaco deleted "Category:Palestinian Writers" (content was: '#redirect [[:Palestinian writers]]')
- 22:56, 2 Jun 2004 Guanaco deleted "Category:Football (soccer) teams" (content was: 'Don't use. See [[:Category:Football (soccer) clubs]]')
- 22:56, 2 Jun 2004 Guanaco deleted "Category:Football (soccer) team" (content was: 'Don't use. See [[:Category:Football (soccer) clubs]]')
- 22:56, 2 Jun 2004 Guanaco deleted "Category:Authors" (content was: 'See [[:category:Writers]].')
- 22:56, 2 Jun 2004 Guanaco deleted "Category:British actors" (content was: 'Needs deletion. Use 'British actors and actresses' instead.')
- 22:56, 2 Jun 2004 Guanaco deleted "Category:North American Countries" (content was: '#REDIRECT[[North American countries]]')
- 22:55, 2 Jun 2004 Guanaco deleted "Category:Star wars computer games" (content before blanking was: '[[Category:Computer games]]')
- 22:55, 2 Jun 2004 Guanaco deleted "Category:Archaeologist" (content before blanking was: 'This is a list of [[archaeologist]]s. Which should really be '''Archaeologists''' not Archaeologist. Please don't add anything more to this category: ...')
- 22:55, 2 Jun 2004 Guanaco deleted "Category:Fictional Universes" (content was: '#REDIRECT [[:Category:Fictional universes]]')
- 22:54, 2 Jun 2004 Guanaco deleted "Category:Defunct American Football Leagues" (content was: '#REDIRECT [[:Category:Defunct American football leagues]]')
- 22:54, 2 Jun 2004 Guanaco deleted "Category:American Football Teams" (content was: '#REDIRECT [[:Category:American football teams]]')
- 22:54, 2 Jun 2004 Guanaco deleted "Category:Defunct Ice Hockey Leagues" (content was: '#REDIRECT [[:Category:Defunct ice hockey leagues]]')
- 22:54, 2 Jun 2004 Guanaco deleted "Category:Defunct Sports Leagues" (content was: '#REDIRECT [[:Category:Defunct sports leagues]]')
- 22:53, 2 Jun 2004 Guanaco deleted "Category:Chemical element" (content was: '#REDIRECT[[Category:Chemical elements]]')
- 22:53, 2 Jun 2004 Guanaco deleted "Category:Ice Hockey" (content was: 'Articles about [[ice hockey]] are not categorized here but under [[:Category:Ice hockey]].')
- 22:53, 2 Jun 2004 Guanaco deleted "Category:Defunct Ice Hockey Teams" (content was: 'Articles about defunct [[ice hockey]] teams are not categorized here but under [[:Category:Defunct ice hockey teams]].')
- 22:53, 2 Jun 2004 Guanaco deleted "Category:Ice Hockey Teams" (content was: 'Articles about [[ice hockey]] teams are not categorized here but under [[:Category:Ice hockey teams]].')
- 22:53, 2 Jun 2004 Guanaco deleted "Category:Ice Hockey Players" (content was: '[[Ice hockey]] players are not categorized here but under [[:Category:Ice hockey players]].')
- 22:53, 2 Jun 2004 Guanaco deleted "Category:Ice Hockey Leagues" (content was: 'Articles about [[ice hockey]] leagues are not categorized here but under [[:Category:Ice hockey leagues]].')
- 22:52, 2 Jun 2004 Guanaco deleted "Category:Transgender, sex, and gender" (content was: '[[Category:Transgender-related topics]]')
- 22:50, 2 Jun 2004 Guanaco deleted "Category:American Football Leagues" (content was: '#REDIRECT [[:Category:American football leagues]]')
- 22:49, 2 Jun 2004 Texture deleted "Talk:Lewis Miller" (no article - content was: ' I agree and i think that it should be better explained')
- 22:49, 2 Jun 2004 Guanaco deleted "Category:Web browers" (content before blanking was: '[[Category: Software]]')
- 22:43, 2 Jun 2004 UtherSRG deleted "Marcelino "Chalino" Vallejo Sánchez" (content was: '{(msg:delete)} Adan Chalino Sanchaz Adan we would always be loving you and we are never going to forget you i hope that you are s...')
- 22:43, 2 Jun 2004 UtherSRG deleted "Category:Sexual transition-related topics" (content was: '[[Category:Transgender-related topics]]This cathegory is completely inappropriately named, I put it up on [[Wikipedia:Categories for deletion]]. The...')
- 22:42, 2 Jun 2004 Sverdrup deleted "Andrew Patman" (content was: ':)')
- 22:37, 2 Jun 2004 Sverdrup deleted "Lewis Miller" (content was: 'I think that this is stupid and i thought that this page was going to be picture of the atr work so you should make it more clear what this really is...')
- 22:33, 2 Jun 2004 Texture deleted "Chris Gilmore" (content was: 'A really loud, drunken, surly, but incredibly handsome Irish-Canadian punkrocker from Ontario. Chances are this kid might be the next Prime Minister o...')
- 22:22, 2 Jun 2004 Wile E. Heresiarch deleted "Ramsbottom" (patent nonsense according to trustworthy users)
- 22:09, 2 Jun 2004 UtherSRG deleted "List of jewelry designers" (content was: '{(msg:delete)}*[[Lori Bonn]]*[[Sophia Forero]]*[[Liz Palacios]]*[[Elsa Peretti]]')
- 22:04, 2 Jun 2004 UtherSRG deleted "Category:Web sites" (content was: 'Use [[:Category:Websites]] instead.')
- 21:57, 2 Jun 2004 Jfdwolff deleted "User talk:Jfdwolff/Archive" (Old archive of my talk page, now moved to a numbered version)
- 21:49, 2 Jun 2004 Tom- deleted "IWPCUG" (content was: 'Hello,This WIKI is primarily for the use by members of IWPCUG to discuss any topic they choose that is related to the objectives of the group.You ...')
- 21:48, 2 Jun 2004 Francs2000 deleted "Yambio" (advert)
- 21:42, 2 Jun 2004 John Kenney deleted "Athamas" (content was: '#REDIRECT [[Athamas (old)]]')
- 21:36, 2 Jun 2004 Francs2000 deleted "Boldesti-Scaeni" (test)
- 21:34, 2 Jun 2004 Texture deleted "The Lovers" (content was: ''''The lovers''' is one of the major arcana of the Rider deck. It symbolizes love but in many ways.')
- 21:32, 2 Jun 2004 Francs2000 deleted "David (Shen) Verdesi" (content was: 'David traveled all over the world in seek for knowledge.Currently he teaches qigong in Turkey mainly.')
- 21:30, 2 Jun 2004 Francs2000 deleted "Republic of Talossa" (patent nonsense)
- 21:02, 2 Jun 2004 Lord Emsworth deleted "United States Constitutional Convention" (prepare for page move)
- 20:57, 2 Jun 2004 Texture deleted "Inundation" (content was: 'hso sg')
- 20:51, 2 Jun 2004 Texture deleted "Talk:Islam in the United Kingdom" (content was: 'how many muslems are in the uk?')
- 20:51, 2 Jun 2004 Texture deleted "Islam in the United Kingdom" (content was: '{(msg:delete)}Islam is a growing religion in the UK, despite the cultural difficulties Muslims entering the UK are faced with.')
- 20:49, 2 Jun 2004 Texture deleted "Yusul" (content was: 'A Korean martial art that little information is known at the time.')
- 20:47, 2 Jun 2004 Texture deleted "Art design" (content was: '{(msg:delete)}')
- 20:27, 2 Jun 2004 DavidWBrooks deleted "Ball tag" (content was: 'hey jay, just wanted to let you know that i am thinking of you')
- 20:22, 2 Jun 2004 DavidWBrooks deleted "Chip Pickering" (content was: ''''Charles W. 'Chip' Pickering Jr.'''')
- 20:22, 2 Jun 2004 DavidWBrooks deleted "Frank Lucas" (content was: ''''Frank D. Lucas'''{(msg:delete)}')
- 20:03, 2 Jun 2004 Hajor deleted "Category:Puerto Rican poets" (content was: '[[Category:Poets by nationality]]')
- 19:58, 2 Jun 2004 Hajor deleted "Category:Peruvian poets" (content was: '[[Category:Poets by nationality]]')
- 19:56, 2 Jun 2004 Hajor deleted "Category:Nicaraguan poets" (content was: '[[Category:Poets by nationality]]')
- 19:52, 2 Jun 2004 Hajor deleted "Category:Mexican poets" (content was: '[[Category:Poets by nationality]]')
- 19:47, 2 Jun 2004 Hajor deleted "Category:Cuban poets" (content was: '[[Category:Poets by nationality]]')
- 19:45, 2 Jun 2004 LouI deleted "Patrick Freguson" (misspelled title, will add again)
- 19:44, 2 Jun 2004 Maximus Rex deleted "Republic of Talossa" (content was: 'The Republic of Talossa was founded on 1 June 2004 by a group of dissatisfied citizens of the [[micronation]] the [[Kingdom of Talossa]]. As of 2 June...')
- 19:43, 2 Jun 2004 Hajor deleted "Category:Chilean poets" (content was: '[[Category:Poets by nationality]]')
- 19:27, 2 Jun 2004 Infrogmation deleted "Lucky Eddie" (content was: '{(msg:delete)}He's the stupid guy in the Hagar the Horrible comic.')
- 19:25, 2 Jun 2004 Infrogmation deleted "Talk:Xibalba" (content was: 'biatch--[[User:204.108.96.10|204.108.96.10]] 19:10, 2 Jun 2004 (UTC)<nowiki>Insert non-formatted text here</nowiki>')
- 19:15, 2 Jun 2004 Ahoerstemeier deleted "Salinas River" (content was: '[[Media:Example.ogg]][[Image:Example.jpg]][[Link title]]'''Bold text'''jfh')
- 19:14, 2 Jun 2004 Ahoerstemeier deleted "Shock troops" (content were editing experiments)
- 19:07, 2 Jun 2004 Adam Bishop deleted "Gérson" (content was: 'You are at a page that does not exist yet. To create an article on this topic, type in the box below (see the help page for more info). If you are her...')
- 19:02, 2 Jun 2004 Adam Bishop deleted "Justine Pasek" (content was: '{(delete)}';:''This page has been listed on [[Wikipedia:Votes for deletion]]. Please see [[Wikipedia:Votes_for_deletion#{(PAGENAME)}|its entry on th...')
- 18:59, 2 Jun 2004 Adam Bishop deleted "Oregon Dunes National Recreation Area" (content was: 'I remember this place ~*~')
- 18:52, 2 Jun 2004 Ahoerstemeier deleted "Desenrascanço" (content was: 'arte de engonhar soluções de ultima hora')
- 18:48, 2 Jun 2004 Cyrius restored "Hell_in_a_Cell"
- 18:47, 2 Jun 2004 Cyrius deleted "Hell in a Cell" (deleting cut/paste move for proper move, no real editing history)
- 18:44, 2 Jun 2004 DavidWBrooks deleted "McAfee" (content was: '----Please Edit----')
- 18:43, 2 Jun 2004 DavidWBrooks deleted "Bobby Scott" (content was: ''''Robert Cortez 'Bobby' Scott'''')
- 18:43, 2 Jun 2004 DavidWBrooks deleted "Jo Ann Davis" (content was: ''''Jo Ann S. Davis'''')
- 18:23, 2 Jun 2004 DavidWBrooks deleted "Egyptian Arabic" (content was: 'Egyptian Arabic is known as the France dialect of Arabic because of it's romantic vocalization.')
- 18:23, 2 Jun 2004 DavidWBrooks deleted "Love Is Hell" (vandalism)
- 18:11, 2 Jun 2004 DavidWBrooks deleted "Noelle" (content was: '{(delete)}Noelle Rivera smells')
- 18:10, 2 Jun 2004 DavidWBrooks deleted "Artemis (software)" (content was: 'http://www.opus360.com/Project Managementfo real.')
- 18:05, 2 Jun 2004 Wile E. Heresiarch deleted "ANLC" (content was: '#REDIRECT [[Partit Nacionalista Liberal de Catalunya]]')
- 18:05, 2 Jun 2004 Wile E. Heresiarch deleted "PNLC" (content was: '#REDIRECT [[Partit Nacionalista Liberal de Catalunya]]')
- 18:02, 2 Jun 2004 Wile E. Heresiarch deleted "Arab Khamula" (consensus to delete on vfd)
- 17:54, 2 Jun 2004 DavidWBrooks deleted "Joyce Olushola" (content was: 'Joyce 'O' belongs to the University of Florida's Preview Staff. There are rumors that claim that she rocks.')
- 17:54, 2 Jun 2004 Wile E. Heresiarch deleted "Partit Nacionalista Liberal de Catalunya" (consensus to delete on vfd)
- 17:50, 2 Jun 2004 DavidWBrooks deleted "Talk:Berthe Morisot" (content was: 'I actually dont give a shit about this site, its just a school project...VOLLEYBALL RULES!! L8er.>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>...')
- 17:49, 2 Jun 2004 Guanaco deleted "User:Guanaco/Sandbox" (content was: 'vbbdfkbjmdfklbdfkl')
- 17:46, 2 Jun 2004 Guanaco deleted "Foreign Investment Review Agency" (content was: 'i poop lots{(msg:delete)}')
- 17:43, 2 Jun 2004 Guanaco deleted "Alice in Videoland" (content was: ''''Bold text'''Alice in Videoland RULES!{(msg:delete)}')
- 17:35, 2 Jun 2004 DJ Clayworth deleted "Ethical intuitionism" (content was: 'ethical intutionism')
- 17:34, 2 Jun 2004 DJ Clayworth deleted "Wikipedia:Dewey Decimal System/020" (content was: 'hi hello')
- 17:32, 2 Jun 2004 Wile E. Heresiarch deleted "Toas" (listed on vfd, 3 to delete (counting me), 1 to keep)
- 17:21, 2 Jun 2004 DavidWBrooks deleted "Talk:Berthe Morisot" (content was: 'i don't like art. i'm only on this site for a project. go hockey. this is stupid if u can edit other people's work. what they say is up to them and if...')
- 17:03, 2 Jun 2004 Infrogmation deleted "Mellow The Band" (external link only; content was: 'www.mellowtheband.com')
- 16:48, 2 Jun 2004 DavidWBrooks deleted "ZQuake" (content was: 'A modification of [[QuakeWorld]] with focus on stability, compatibility, ease-of-use and what else?Home page: http://zquake.frag.ru')
- 16:48, 2 Jun 2004 DavidWBrooks deleted "Tennis For Two" (content was: 'This is the first video game. Called, 'Tennis For Two' this is a game of tennis. Two people play. It has two controllers and hooks two your T.V.. It h...')
- 16:46, 2 Jun 2004 DavidWBrooks deleted "Logo Against Intellectual Property and Copyright" (content was: 'am trying to check whether this text will be displayed or not')
- 16:42, 2 Jun 2004 Guanaco deleted "Sequence homology" (content was: 'MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGDEKMGGEDDEL...')
- 16:38, 2 Jun 2004 Infrogmation deleted "Moscow Style" (content was: '[[Media:Example.ogg]][[Image:Example.jpg]]')
- 16:29, 2 Jun 2004 Texture deleted "Campaign Life Coalition" (content was: '{(msg:delete)}Do you think it is fair that the Government will pay for Abortions and Sex Changes, but will not help desperate couples have children ...')
- 16:29, 2 Jun 2004 Texture deleted "Talk:Monica --" (discussion page for user test)
- 16:27, 2 Jun 2004 Texture deleted "Monica --" (user test)
- 16:27, 2 Jun 2004 Guanaco deleted "Beamish Museum" (content was: 'Beamish Museum is a exiting day out for the family. It gives you an insite to how things used to be. They also have coffee shops sweet shops and cafe ...')
- 16:26, 2 Jun 2004 Ahoerstemeier deleted "Jessicaism" (content was: 'Jessicaism:This is the best religion ever. We believe in a higher power but we think church is wack so we made our OWN rules. Rule 1: No churchRu...')
- 16:23, 2 Jun 2004 Ahoerstemeier deleted "Elementary Education" (content before blanking was: 'How do we, as science educators, empower elementary teachers to engage their students in ''inquiry learning''?')
- 16:21, 2 Jun 2004 Infrogmation deleted "Smartism" (content was: 'smartism is the religion of smart people. we unite to pray to the gods of genius. everyone should join this religon if they are smart.')
- 16:19, 2 Jun 2004 Warofdreams deleted "Jessicaism" (nonsense)
- 16:00, 2 Jun 2004 Hephaestos deleted "Uranium glass" (content was: 'URANIUM GLASS IS ... LAME')
- 15:59, 2 Jun 2004 DJ Clayworth deleted "Monica-not the singer" (a vanity page with almost no content and enough invective to be considered vandalism)
- 15:51, 2 Jun 2004 DJ Clayworth deleted "MEAN" (content was: '{(delete)}Yes, you know - MEAN - what I'M not, and YOU sometimes are.')
- 14:58, Jun 2, 2004 Dori deleted "Talk:Prophets of Islam" (content was: '== Headline text ==dsftg== Headline text ==[[Image:Example.jpg]][[Media:Example.ogg]]<math>Insert formula here</math><nowiki>Insert non-formatted t...')
- 14:55, 2 Jun 2004 UtherSRG deleted "Popular literature" (content was: '{(msg:Vfd)}popular literature' (not really VFD... ))
- 14:55, 2 Jun 2004 Wile E. Heresiarch deleted "PsyØk" (speed delete, item 4: content was: '{(vfd)}'''PsyØk''' pronounced 'zok' is a philosopher and underground experimental musician appearing in the late 90s.::{(stub)}')
- 14:50, 2 Jun 2004 UtherSRG deleted "FA Trophy/Temp"
- 14:43, 2 Jun 2004 Ahoerstemeier deleted "Steve Jay" (content were editing experiments)
- 14:30, 2 Jun 2004 Ahoerstemeier deleted "Anthony Faas" (content was: 'Anothony Faas's last name is Faas')
- 14:27, 2 Jun 2004 Ahoerstemeier deleted "Ballistic trajectory" (content was: 'so ur telling me that we have to friggin post what we think this is on an encyclopedia website?!')
- 14:25, 2 Jun 2004 Ahoerstemeier deleted "Djúpavík" (content was: '[http://www.islandsmyndir.is/html_skjol/vestfirdir/djupavik/yfirlit_djupavik1.htm Djúpavík - picture gallery from islandsmyndir.is]')
- 14:25, 2 Jun 2004 Ahoerstemeier deleted "Calaroga" (content was: '{(msg:delete)}')
- 14:18, 2 Jun 2004 Ahoerstemeier deleted "Field artillery" (content was: '{(msg:delete)}this is alllll wrong.')
- 14:00, 2 Jun 2004 Meelar deleted "Popular literature" (content was: 'popular literature')
- 13:46, 2 Jun 2004 Stan Shebs deleted "Anguis fragilis" (content was: ''''FSDFSD'''')
- 12:56, 2 Jun 2004 UtherSRG deleted "Desenrascanço" (content was: '{(msg:delete)}ja tiraram a definição original, mas em modos gerais o desenrascanço é conseguir que algém faça por nós algo que temos preguiça de faz...')
- 12:52, 2 Jun 2004 Ahoerstemeier deleted "Dina" (content was: ''''Dinomite Dina'''')
- 12:25, 2 Jun 2004 Ahoerstemeier deleted "Culture of the United Arab Emirates" (content was: 'what are the traditional family values in the UAE? do they value family unity? i heard extended family often lives together? is this true? can u tel...')
- 12:22, 2 Jun 2004 Jimfbleak deleted "Treaty of London, 1949" (Wikipedia is not a source dump)
- 12:18, 2 Jun 2004 Jimfbleak deleted "Azn evo@hotmail.com" (immature junk)
- 12:09, 2 Jun 2004 Jfdwolff deleted "Hemisphere (brain)" (wrote this before finding [[cerebral hemisphere]])
- 11:54, 2 Jun 2004 Chris 73 deleted "Azn evo@hotmail.com" (content was: 'please add me if you have MSN, or send me mails because i am a loser.. If you want to add me, it's azn_evo@hotmail.comHAHAHAHA...I eat crap......')
- 11:51, 2 Jun 2004 Angela deleted "Talk:Circadian clock" (Listed on [[Wikipedia:Copyright problems]])
- 11:46, 2 Jun 2004 Angela deleted "Circadian clock" (Listed on [[Wikipedia:Copyright problems]])
- 11:45, 2 Jun 2004 Angela deleted "Churcher's College" (Listed on [[Wikipedia:Copyright problems]])
- 11:44, 2 Jun 2004 Angela deleted "Virtual table" (Listed on [[Wikipedia:Copyright problems]])
- 11:43, 2 Jun 2004 Angela deleted "Yakov Yurovsky" (Listed on [[Wikipedia:Copyright problems]])
- 11:42, 2 Jun 2004 Angela deleted "FA Trophy" (Listed on [[Wikipedia:Copyright problems]])
- 11:42, 2 Jun 2004 Angela deleted "Goatrance" (Listed on [[Wikipedia:Copyright problems]])
- 11:42, 2 Jun 2004 Angela deleted "Cazzey" (Listed on [[Wikipedia:Copyright problems]])
- 11:42, 2 Jun 2004 Angela deleted "Tim Rodber" (Listed on [[Wikipedia:Copyright problems]])
- 11:39, 2 Jun 2004 Angela deleted "Candu" (Listed on Wikipedia:Copyright_problems)
- 11:39, 2 Jun 2004 Angela deleted "Kumar Sanu/Temp" (listed on Wikipedia:Copyright_problems)
- 11:38, 2 Jun 2004 Angela deleted "History of machine translation" (Listed on Wikipedia:Copyright_problems)
- 11:37, 2 Jun 2004 Angela deleted "Betty Mahmoody" (Listed on [[Wikipedia:Copyright problems]] since [[May 24]])
- 11:37, 2 Jun 2004 Angela deleted "El Castillo" (Listed on [[Wikipedia:Copyright problems]] since [[May 24]])
- 11:37, 2 Jun 2004 Angela deleted "Clifton Matthews" (Listed on [[Wikipedia:Copyright problems]] since [[May 24]])
- 11:37, 2 Jun 2004 Angela deleted "Kumar Sanu" (Listed on [[Wikipedia:Copyright problems]] since [[May 24]])
- 11:37, 2 Jun 2004 Angela deleted "Rahmat Ali" (Listed on [[Wikipedia:Copyright problems]] since [[May 24]])
- 11:36, 2 Jun 2004 Angela deleted "Citizens Commission on Human Rights" (Listed on [[Wikipedia:Copyright problems]] since [[May 24]])
- 11:29, 2 Jun 2004 Angela deleted "Josef Matthias Hauer" (listed on [[Wikipedia:Copyright problems]] since May 18)
- 11:29, 2 Jun 2004 Angela deleted "Milena Debenedetti" (listed on [[Wikipedia:Copyright problems]] since May 18)
- 11:24, 2 Jun 2004 Angela deleted "Jacopo da Bologna" (liste on [[Wikipedia:Copyright problems]] since May 17)
- 11:24, 2 Jun 2004 Angela deleted "Wolfgang von Schweinitz" (liste on [[Wikipedia:Copyright problems]] since May 17)
- 11:23, 2 Jun 2004 Chris 73 deleted "Statechart (UML)" (content was: '----------[[User:202.54.137.248|202.54.137.248]] 11:09, 2 Jun 2004 (UTC)<nowiki>Insert non-formatted text here</nowiki><math>Insert formula here</...')
- 11:22, 2 Jun 2004 Angela deleted "Alpine states" (listed on [[Wikipedia:Copyright problems]])
- 11:19, 2 Jun 2004 Angela deleted "Talk:Worsthorne" (talk page of deleted copyvio)
- 11:18, 2 Jun 2004 Angela deleted "Worsthorne" (listed on [[Wikipedia:Copyright problems]])
- 11:12, 2 Jun 2004 Angela deleted "Talk:Colloid chemistry" (talk page of deleted copyvio)
- 11:12, 2 Jun 2004 Angela deleted "Colloid chemistry" (listed on Wikipedia:Copyright problems)
- 11:11, 2 Jun 2004 Angela deleted "Talk:Fritz Pregl" (talk page of deleted copyvio)
- 11:10, 2 Jun 2004 Angela deleted "Fritz Pregl" (listed on [[Wikipedia:Copyright problems]])
- 11:03, 2 Jun 2004 Ahoerstemeier deleted "Sodium azide" (content was: 'this is a fucked up web page! fuck u')
- 10:58, 2 Jun 2004 Tom- deleted "Nissan Skyline" (content was: 'the nissan skyline was made in 2000 a.d and was the very best trog couldget 4 his money')
- 10:55, 2 Jun 2004 Danny deleted "North Redwood" (content was: '#REDIRECT [[North Redwood, Minnesota]]')
- 10:51, 2 Jun 2004 Angela deleted "Image:Enblocclips.jpg" (listed on [[Wikipedia:Copyright problems]])
- 10:48, 2 Jun 2004 Danny deleted "North Puyallup" (content was: '#REDIRECT [[North Puyallup, Washington]]')
- 10:40, 2 Jun 2004 Tom- deleted "Lester Grinspoon" (content was: 'asdfasdfsadfsadf')
- 10:40, 2 Jun 2004 Angela deleted "De Koninklijke Porceleyne Fles" (listed on [[Wikipedia:Copyright_problems]] with no response for request for permission after nearly a month)
- 10:29, 2 Jun 2004 Ahoerstemeier deleted "Culture of Greenland" (content was: 'greenland natives like snow and bells, they are also fans of salt.')
- 10:29, 2 Jun 2004 Angela deleted "Image:Saumur.jpg" (on [[Wikipedia:Copyright problems]] for a month)
- 10:12, 2 Jun 2004 Angela deleted "Zazaki" (recreation of already deleted copyvio)
- 10:09, 2 Jun 2004 Angela deleted "Talk:FK Sartid/Temp" (moved to main namespace)
- 10:08, 2 Jun 2004 Angela restored "FK_Sartid"
- 10:08, 2 Jun 2004 Tom- deleted "Christian Children's Fund" (content was: 'OWLS!')
- 10:07, 2 Jun 2004 Angela deleted "FK Sartid" (listed on [[/Wikipedia:Copyright_problems#April_26]])
- 10:06, 2 Jun 2004 Angela deleted "FK Sartid" (listed on [[/Wikipedia:Copyright_problems#April_26]])
- 10:01, 2 Jun 2004 Angela deleted "The Cavaliers" (listed on [[Wikipedia:Copyright problems]] for a month with no confirmation of permission received)
- 10:01, 2 Jun 2004 Angela deleted "Talk:The Cavaliers" (talk page of deleted article)
- 10:00, 2 Jun 2004 Angela deleted "The Protocols of the Elders of Zion/Temp" (temp page moved to main namespace)
- 09:58, 2 Jun 2004 Angela deleted "The Protocols of the Elders of Zion" (deleting copyvio listed on [[Wikipedia:Copyright problems]] for over a month)
- 08:18, 2 Jun 2004 Jmabel deleted "Chang Myon" (content was: '[[Media:Example.ogg]]<m------[[User:210.49.63.28|210.49.63.28]] 07:53, 2 Jun 2004 (UTC)ath>Insert formula here</math>[[Image:Example.jpg]][[Link tit...')
- 08:11, 2 Jun 2004 John Kenney deleted "Graham Greene" (an unnecessary disambiguation page - moving article on the writer back here)
- 08:07, 2 Jun 2004 Jmabel deleted "Smoking (movie)" (was just a remark, not an article)
- 08:04, 2 Jun 2004 Maximus Rex deleted "Anabel Conde" (content was: 'www.anabelconde.ya.st , la pagina donde encontraras todo sobre la mejor cantante de eurovision')
- 07:56, 2 Jun 2004 Hadal deleted "Anthropometrics" (content was: 'Thomas William Finch Born in 1989')
- 07:55, 2 Jun 2004 Hadal deleted "Thomas William Finch Boy Inventor" (content was: 'This is my life as i think it is, but i do not know much so ask someone else.')
- 07:52, 2 Jun 2004 Hadal deleted "Fannybaws" (content was: 'Fannybaws:-Wikipedia editors')
- 07:48, 2 Jun 2004 Jmabel deleted "Medial pterygoid muscle" (Question moved to Spanish-language reference desk (w/ email addr for response). Content was: '== Headline text ==ratones por favor mandenme informaci´n sobre este musculo a la siguiente dirección gasnapiro@hotail.com gracias mentes por todo!...')
- 07:40, 2 Jun 2004 John Kenney deleted "Fyodor Dostoevsky" (content was: '#REDIRECT [[Fyodor Dostoevsky (old)]]' - no history, moving main article here)
- 06:52, 2 Jun 2004 Hadal deleted "Shitebag" (content before blanking was: '1. A bag of [[shite]]2. An unusually timid individual3. Intestines')
- 06:50, 2 Jun 2004 Hadal deleted "Jobby" (content before blanking was: 'Aka number 2Faecal mattershitbowel movementanal excretaetc.')
- 05:47, 2 Jun 2004 Infrogmation deleted "Jordan Levin" (uninformative sub stub, not even with info in the one article that links here. content was: 'Jordan levin is the decider of the fate of shows on the WB network. Has made some bad decisions including the cancellation of 'Angel' the series.')
- 05:44, Jun 2, 2004 RickK deleted "Fopb" (content was: 'Free of Personal Bias')
- 05:36, 2 Jun 2004 WhisperToMe deleted "Sei Taîshogun" (Incorrect romanization)
- 05:28, Jun 2, 2004 RickK deleted "Ghana Empire" (copied from Encylopedia Brittanica, then deleted by original poster)
- 05:24, Jun 2, 2004 RickK deleted "Stupid administrater deleting my hard work" (content was: 'This is not the administrator.This is a stupid young lad who should stop what he is doing.Now.')
- 05:08, 2 Jun 2004 Hadal deleted "Mantastic" (content was: 'To be brave, heroic, handsome, witty and all things virtuous')
- 05:08, 2 Jun 2004 Hadal deleted "Exitamafied" (content was: 'the verb of exite')
- 05:08, 2 Jun 2004 Hadal deleted "Ben" (content was: 'the sexiest man in the universe')
- 04:46, 2 Jun 2004 Adam Bishop deleted "Candy Barr" (content was: 'She ate candy then she got fat like you.')
- 04:44, 2 Jun 2004 Hadal deleted "Bunnie Rabbot" (content was: 'eh?')
- 04:42, 2 Jun 2004 Hephaestos deleted "Steve Guttenberg" (content was: '[http://www.steveguttenberg.net Steve Guttenberg Guttefans]')
- 04:41, 2 Jun 2004 Hadal deleted "Flight Options" (content before blanking was: 'this is a test')
- 04:36, 2 Jun 2004 Chris 73 deleted "Zweite Schritte" (duplicate of http://de.wikipedia.org/wiki/Wikipedia:Zweite_Schritte)
- 04:25, 2 Jun 2004 Hadal deleted "Jane Gregory" (content was: ''''Bold text'''== Headline text ==[[Media:Example.ogg]]<math>Insert formula here</math>------[[User:200.89.166.209|200.89.166.209]] 04:24, 2 Jun 2...')
- 04:16, Jun 2, 2004 Dori deleted "Image:Picture.png" (user requested rename/deletion, file reuploaded as [[:Image:Squash Use Picture.png]])
- 04:15, 2 Jun 2004 Chris 73 deleted "Descent (aircraft)" (content was: '{(msg:delete)}The '''descent''' during flight involves a decrease in altitude.')
- 04:14, 2 Jun 2004 Chris 73 deleted "Temple Bar Dublin" (content was: '{(msg:delete)}')
- 04:14, 2 Jun 2004 Chris 73 deleted "List of airlines in malaysia" (content was: '{(msg:delete)}lists of airlines and their address in kualalumpur, Malayisa.')
- 04:14, 2 Jun 2004 Chris 73 deleted "Bouillabaisse" (content was: '{(msg:delete)}It's a stew made of different types of fish.')
- 04:13, 2 Jun 2004 Texture deleted "Cell Games Saga" (nonsense / user test)
- 04:11, 2 Jun 2004 Texture deleted "* Aquas" (content was: '{(msg:delete)}#REDIRECT [[Aquas]]')
- 04:07, 2 Jun 2004 Maximus Rex deleted "Peppercorn" (content was: 'According to [[Merriam-Webster]]'s entry of peppercorn [http://www.m-w.com/cgi-bin/dictionary?book=Dictionary&va=peppercorn&x=0&y=0 here]:Main Entry...')
- 03:40, 2 Jun 2004 Hephaestos deleted "Claire Chow" (content was: 'Claire Chow didn't win the award for loudest asst. immigration officer of the world. Sorry!')
- 03:32, 2 Jun 2004 Michael Snow deleted "Template:Shortcut" (clearing for move)
- 03:17, 2 Jun 2004 Chris 73 deleted "User:Burgundavia/test3" (deleted on request by user)
- 03:17, 2 Jun 2004 Chris 73 deleted "User:Burgundavia/test2" (deleted on request by user)
- 03:17, 2 Jun 2004 Chris 73 deleted "User:Burgundavia/test" (deleted on request by user)
- 02:58, 2 Jun 2004 Guanaco deleted "Image:Norfolk island flag medium.png" (IFD/Flags)
- 02:58, 2 Jun 2004 Guanaco deleted "Image:Niue flag medium.png" (IFD/Flags)
- 02:58, 2 Jun 2004 Guanaco deleted "Image:Nigeria flag medium.png" (IFD/Flags)
- 02:58, 2 Jun 2004 Guanaco deleted "Image:Niger flag medium.png" (IFD/Flags)
- 02:58, 2 Jun 2004 Guanaco deleted "Image:Nicaragua flag medium.png" (IFD/Flags)
- 02:58, 2 Jun 2004 Guanaco deleted "Image:Netherlands antilles flag medium.png" (IFD/Flags)
- 02:58, 2 Jun 2004 Guanaco deleted "Image:Netherlands flag medium.png" (IFD/Flags)
- 02:57, 2 Jun 2004 Guanaco deleted "Image:Nepal flag medium.png" (IFD/Flags)
- 02:56, 2 Jun 2004 Guanaco deleted "Image:Nauru flag medium.png" (IFD/Flags)
- 02:56, 2 Jun 2004 Guanaco deleted "Image:Namibia flag medium.png" (IFD/Flags)
- 02:56, 2 Jun 2004 Guanaco deleted "Image:Myanmar flag medium.png" (IFD/Flags)
- 02:56, 2 Jun 2004 Guanaco deleted "Image:Mozambique flag medium.png" (IFD/Flags)
- 02:56, 2 Jun 2004 Guanaco deleted "Image:Morocco flag medium.png" (IFD/Flags)
- 02:56, 2 Jun 2004 Guanaco deleted "Image:Mongolia flag medium.png" (IFD/Flags)
- 02:56, 2 Jun 2004 Guanaco deleted "Image:Monaco flag medium.png" (IFD/Flags)
- 02:56, 2 Jun 2004 Guanaco deleted "Image:Moldova flag medium.png" (IFD/Flags)
- 02:55, 2 Jun 2004 Guanaco deleted "Image:Micronesia flag medium.png" (IFD/Flags)
- 02:55, 2 Jun 2004 Guanaco deleted "Image:Mexico flag medium.png" (IFD/Flags)
- 02:54, 2 Jun 2004 Guanaco deleted "Image:Mauritius flag medium.png" (IFD/Flags)
- 02:54, 2 Jun 2004 Guanaco deleted "Image:Mauritania flag medium.png" (IFD/Flags)
- 02:54, 2 Jun 2004 Guanaco deleted "Image:Marshall islands flag medium.png" (IFD/Flags)
- 02:54, 2 Jun 2004 Guanaco deleted "Image:Man flag medium.png" (IFD/Flags)
- 02:54, 2 Jun 2004 Guanaco deleted "Image:Malta flag medium.png" (IFD/Flags)
- 02:54, 2 Jun 2004 Guanaco deleted "Image:Mali flag medium.png" (IFD/Flags)
- 02:54, 2 Jun 2004 Guanaco deleted "Image:Maldives flag medium.png" (IFD/Flags)
- 02:54, 2 Jun 2004 Guanaco deleted "Image:Malaysia flag medium.png" (IFD/Flags)
- 02:53, 2 Jun 2004 Guanaco deleted "Image:Malawi flag medium.png" (IFD/Flags)
- 02:52, 2 Jun 2004 Guanaco deleted "Image:Madagascar flag medium.png" (IFD/Flags)
- 02:53, 2 Jun 2004 Guanaco deleted "Image:Macedonia flag medium.png" (IFD/Flags)
- 02:52, 2 Jun 2004 Guanaco deleted "Image:Macao flag medium.png" (IFD/Flags)
- 02:52, 2 Jun 2004 Guanaco deleted "Image:Luxembourg flag medium.png" (IFD/Flags)
- 02:52, 2 Jun 2004 Guanaco deleted "Image:Lithuania flag medium.png" (IFD/Flags)
- 02:52, 2 Jun 2004 Guanaco deleted "Image:Liechtenstein flag medium.png" (IFD/Flags)
- 02:52, 2 Jun 2004 Guanaco deleted "Image:Libya flag medium.png" (IFD/Flags)
- 02:52, 2 Jun 2004 Guanaco deleted "Image:Liberia flag medium.png" (IFD/Flags)
- 02:52, 2 Jun 2004 Guanaco deleted "Image:Lesotho flag medium.png" (IFD/Flags)
- 02:51, 2 Jun 2004 Guanaco deleted "Image:Kazakhstan flag medium.png" (IFD/Flags)
- 02:51, 2 Jun 2004 Guanaco deleted "Image:Kenya flag medium.png" (IFD/Flags)
- 02:51, 2 Jun 2004 Guanaco deleted "Image:Kiribati flag medium.png" (IFD/Flags)
- 02:51, 2 Jun 2004 Guanaco deleted "Image:North korea flag medium.png" (IFD/Flags)
- 02:50, 2 Jun 2004 Guanaco deleted "Image:South korea flag medium.png" (IFD/Flags)
- 02:51, 2 Jun 2004 Guanaco deleted "Image:Kuwait flag medium.png" (IFD/Flags)
- 02:50, 2 Jun 2004 Guanaco deleted "Image:Kyrgyzstan flag medium.png" (IFD/Flags)
- 02:50, 2 Jun 2004 Guanaco deleted "Image:Laos flag medium.png" (IFD/Flags)
- 02:50, 2 Jun 2004 Guanaco deleted "Image:Latvia flag medium.png" (IFD/Flags)
- 02:50, 2 Jun 2004 Guanaco deleted "Image:Lebanon flag medium.png" (IFD/Flags)
- 02:49, 2 Jun 2004 Guanaco deleted "Image:Guam flag medium.png" (IFD/Flags)
- 02:49, 2 Jun 2004 Guanaco deleted "Image:Guatemala flag medium.png" (IFD/Flags)
- 02:49, 2 Jun 2004 Guanaco deleted "Image:Guernsey flag medium.png" (IFD/Flags)
- 02:49, 2 Jun 2004 Guanaco deleted "Image:Guinea flag medium.png" (IFD/Flags)
- 02:49, 2 Jun 2004 Guanaco deleted "Image:Guinea bissau flag medium.png" (IFD/Flags)
- 02:49, 2 Jun 2004 Guanaco deleted "Image:Guyana flag medium.png" (IFD/Flags)
- 02:49, 2 Jun 2004 Guanaco deleted "Image:Haiti flag medium.png" (IFD/Flags)
- 02:48, 2 Jun 2004 Guanaco deleted "Image:Honduras flag medium.png" (IFD/Flags)
- 02:49, 2 Jun 2004 Guanaco deleted "Image:Hong kong flag medium.png" (IFD/Flags)
- 02:48, 2 Jun 2004 Guanaco deleted "Image:Hungary flag medium.png" (IFD/Flags)
- 02:48, 2 Jun 2004 Guanaco deleted "Image:Iceland flag medium.png" (IFD/Flags)
- 02:48, 2 Jun 2004 Guanaco deleted "Image:India flag medium.png" (IFD/Flags)
- 02:48, 2 Jun 2004 Guanaco deleted "Image:Indonesia flag medium.png" (IFD/Flags)
- 02:48, 2 Jun 2004 Guanaco deleted "Image:Iran flag medium.png" (IFD/Flags)
- 02:48, 2 Jun 2004 Guanaco deleted "Image:Iraq flag medium.png" (IFD/Flags)
- 02:48, 2 Jun 2004 Guanaco deleted "Image:Ireland flag medium.png" (IFD/Flags)
- 02:48, 2 Jun 2004 Guanaco deleted "Image:Italy flag medium.png" (IFD/Flags)
- 02:47, 2 Jun 2004 Maximus Rex deleted "Sweet alyssum" (content was: 'THe Sweet Alyssum is a 3-headed, 2 faced monster.')
- 02:47, 2 Jun 2004 Maximus Rex deleted "Mary the Jewess" (content before blanking was: 'crazy crazy crazy')
- 02:44, 2 Jun 2004 Guanaco deleted "Image:Grenada flag medium.png" (IFD/Flags)
- 02:44, 2 Jun 2004 Guanaco deleted "Image:Greenland flag medium.png" (IFD/Flags)
- 02:44, 2 Jun 2004 Guanaco deleted "Image:Greece flag medium.png" (IFD/Flags)
- 02:44, 2 Jun 2004 Guanaco deleted "Image:Gibraltar flag medium.png" (IFD/Flags)
- 02:44, 2 Jun 2004 Guanaco deleted "Image:Ghana flag medium.png" (IFD/Flags)
- 02:43, 2 Jun 2004 Guanaco deleted "Image:Germany flag medium.png" (IFD/Flags)
- 02:44, 2 Jun 2004 Guanaco deleted "Image:Georgia flag medium.png" (IFD/Flags)
- 02:43, 2 Jun 2004 Guanaco deleted "Image:Gambia flag medium.png" (IFD/Flags)
- 02:43, 2 Jun 2004 Guanaco deleted "Image:Gabon flag medium.png" (IFD/Flags)
- 02:37, 2 Jun 2004 Guanaco deleted "Image:TeamRocket2.png" (orphan duplicate)
- 02:32, 2 Jun 2004 Guanaco restored "Image:TeamRocket.png"
- 02:10, 2 Jun 2004 Hadal deleted "Piano Concerto No. 19 (Mozart)" (content was: '{(msg:delete)}'''Bold text'' The piano concerto No. 19 by Mozart was a very wonderful piece of work!')
- 02:05, 2 Jun 2004 Hadal deleted "Sentry Firewall CD" (content was: '{(msg:delete)}WHAT IS THIS IS IT EXISTIN OR NOT AT ALL DOWNLOAD THE LINUX LIVE CDROUTER INSTEAD THAT EXISTS http://livecdrouter.64bitonline.net/')
- 02:03, 2 Jun 2004 Hadal deleted "Leone Jensen" (content was: '{(msg:delete)}hi my nickname is bratt and I think ghosts are people 2 just like us except they r dead!so i thought i,d learn more about them!')
- 02:01, 2 Jun 2004 Gentgeen deleted "Castle Rock State Park (California)" (deleting to move pre-disambiguation [[Castle Rock State Park]] here)
- 01:05, 2 Jun 2004 Maximus Rex deleted "New historicism" (content was: '{(msg:delete)}New historicism ??')
- 00:49, Jun 2, 2004 Dori deleted "Talk:Joh Bjelke-Petersen" (content was: '[[Media:Example.ogg]]')
- 00:22, 2 Jun 2004 Adam Bishop deleted "Sydney Britton" (content was: ' Sydney Britton was born on July 22,1992.She grew up in the city of Detriot,where she lived in the jeffries projects.She was far more prettier than an...')
- 23:51, 1 Jun 2004 Maximus Rex deleted "Mimi Parent" (content was: '{(delete)}Mimi Parent is commonly known as Mimi from Fraiser. Cool huh? ya I know. Shout out to CHRIS* from Suzart** and Mme.Ouellet*** ...')
- 23:50, 1 Jun 2004 Maximus Rex deleted "Almaden Research Center" (content was: '[http://www.almaden.ibm.com/ IBM Research | Almaden Research Center | Home Page]')
- 23:50, 1 Jun 2004 Maximus Rex deleted "Uptown Girls" (content was: 'I like the part when she is punching her after getting of the tea cups')
- 23:50, 1 Jun 2004 Maximus Rex deleted "Rango Bajo" (content was: '== Headline text =='''Bold text'''''Italic text''[[Link title]]')
- 23:34, 1 Jun 2004 UninvitedCompany deleted "American Football Leagues" (content was: '{(delete)}')
- 23:34, 1 Jun 2004 UninvitedCompany deleted "Presidente Olegário" (content was: '{(delete)}Test')
- 23:33, 1 Jun 2004 UninvitedCompany deleted "Fickerig" (content was: ''Fickerig' is a german term used by pilots to describe certain airplanes and their behavior while ascending and descending. The term is generally used...')
- 23:33, 1 Jun 2004 UninvitedCompany deleted "Too Fast for Love" (content was: '{(msg:delete)}[http://www.absolute-motleycrue.com/fast.html Too Fast For Love Album Details]')
- 23:33, 1 Jun 2004 UninvitedCompany deleted "Chicago Theological Seminary" (content was: '{(delete)}What did James Henry Breasted find wrong with the interpetations of the Bible from the Greek and aramic languages? ...')
- 23:33, 1 Jun 2004 UninvitedCompany deleted "Biloxi Blues" (content was: '{(msg:delete)}A group of young recruits go through boot camp during the Second World War in Biloxi Mississippi.')
- 23:31, Jun 1, 2004 Pollinator deleted "Mimi Parent" (content was: 'Mimi Parent is commonly known as Mimi from Fraiser. Cool huh? ya I know. Shout out to CHRIS* from Suzart and Mme.Ouellet ...')
- 23:29, Jun 1, 2004 Merovingian deleted "William Cook" (content was: 'Brother of cop killer, Wesley Cook.')
- 23:28, Jun 1, 2004 Pollinator deleted "John Africa" (content was: 'Fucking moron who doesn't like technology.')
- 23:24, 1 Jun 2004 Jmabel deleted "Name density" (content was: '{(msg:delete)}Everyone put your name here.If your name exists, edit the number of people with that name. Thanks!Please put this in alphabetical or...')
- 23:22, 1 Jun 2004 Jmabel deleted "Getter Robo" (content was: '{(msg:delete)}Sometimes, when your mom is really making you mad, like when she sends you to your room without supper, you tell your personal robot (...')
- 23:19, 1 Jun 2004 Maximus Rex deleted "American Football Leagues" (content was: 'This category organizes [[American football]] leagues.[[Category:American football]][[Category:Sports Leagues]]')
- 23:09, 1 Jun 2004 Wile E. Heresiarch deleted "KaoSatyr" (content was: '{(delete)}I am requesting that my own page be deleted. I learned how to create a wiki article and create the links to other articles. That is all I ...')
- 22:40, Jun 1, 2004 Eloquence deleted "Template:Totd" (content was: '#REDIRECT [[MediaWiki:Totd]]')
- 22:03, 1 Jun 2004 Ahoerstemeier deleted "MamboServer" (content was: '{(msg:delete)}test test')
- 21:46, 1 Jun 2004 Meelar deleted "Does Lil' fizz has a girl?" (content was: '== Headline text ==FIZZO IS HOTTTTTTT!!!!!!!!!!!! AND SEXY!!!!!!!!! Hey boo i want to meet you i want to sing with you, you make me gooooo crazy l...')
- 21:46, 1 Jun 2004 Ahoerstemeier deleted "Rover 400-series" (content was: '{(msg:delete)}''Italic text''[[Link title]]----[http://www.example.com link title][[Image:Example.jpg]][[Media:Example.ogg]]<math>Insert formula h...')
- 21:44, 1 Jun 2004 Ahoerstemeier deleted "Tennis Elbow" (content was: '{(msg:delete)}May 9, 1992, Remington's birthday; the most important day in the world[[Image:Example.jpg]][[Media:Example.ogg]]')
- 21:04, 1 Jun 2004 Sverdrup deleted "White nationalist FAQ" (delete, as per vfd)
- 21:04, 1 Jun 2004 DJ Clayworth deleted "Nicaraguan Air Force" (content was: 'Maybe they don't have a single plane!')
- 21:04, 1 Jun 2004 UtherSRG deleted "Richie Foley"
- 21:02, 1 Jun 2004 UtherSRG deleted "Category:British politics" (content was: '{(delete)}')
- 21:02, 1 Jun 2004 UtherSRG deleted "Category:British political parties" (content was: '{(delete)}Don't use. See [[:Category:UK political parties]]')
- 20:53, Jun 1, 2004 Jengod deleted "Dickhead" (content was: 'DJ Clayworth.')
- 20:51, Jun 1, 2004 Jengod deleted "Johann Ambrosius Bach" (content was: 'where is [[Link title]]Blowjob? I thought we said blowjob is good! Long live Blowjob!!!!!')
- 20:48, 1 Jun 2004 Sverdrup deleted "William Guzzardi" (consensus on vfd to delete)
- 20:42, 1 Jun 2004 Maximus Rex deleted "Categories:Actors" (content was: 'This category is for people whose primary profession, or claim to fame, is acting.==Subcategories==[[:Category:Film actors]], [[:Category:Stage act...')
- 20:41, 1 Jun 2004 Maximus Rex deleted "Jagdeep Gill" (content was: 'Jagdeep Gill was born in Ascot in February 19th 1984. He spent most of his childhood in the city of Slough. After moving to Vancouver Canada for a few...')
- 20:40, 1 Jun 2004 Sverdrup deleted "Defense Independent Pitching Statistics" (test page)
- 20:40, 1 Jun 2004 Maximus Rex deleted "Godzilla: Final Wars (upcoming)" (content was: 'Here is the link to Toho Studios' official Godzilla Final wars web-site. It is partially in English, but most of the language is Japanese.http://ww...')
- 20:33, 1 Jun 2004 LouI deleted "Theodorick Bland" (misspeled title, will add again)
- 20:27, 1 Jun 2004 DavidWBrooks deleted "Tasty" (content was: '''See also:'' [[Blood Sausage]]')
- 20:25, 1 Jun 2004 UninvitedCompany deleted "Age: Wikipedia talk:Requests for adminship/Archive 17" (cleaning up my mess)
- 20:22, 1 Jun 2004 Maximus Rex deleted "King Leopold's Soliloquy" (content was: '== Headline text ==gfyjfyj ghftg ftrhsdfhser<nowiki>Insert non-formatted text here</nowiki>--[[User:141.157.126.72|141.157.126.72]] 14:27, 1 Jun 20...')
- 20:21, 1 Jun 2004 Francs2000 deleted "Hobart Summer Festival" (content was: '{(msg:delete)}hi how r u?')
- 20:19, 1 Jun 2004 Francs2000 deleted "Hassan Gouled Aptidon" (content was: '{(msg:delete)}Hassan Gouled Aptidon is a son of a bitch and a hore. He sold his body for pussy.')
- 20:18, Jun 1, 2004 Raul654 deleted "47 Ronin" (content was: '#REDIRECT [[Forty-seven Ronin]]')
- 20:18, 1 Jun 2004 Francs2000 deleted "Merritt Junior College" (content was: 'my name is merritt')
- 20:17, 1 Jun 2004 DavidWBrooks deleted "Die Rote Jacke" (content was: 'A good movie.')
- 20:15, 1 Jun 2004 Wile E. Heresiarch deleted "Talk:Michael Pennington conspiracy" (talk page of deleted article)
- 20:13, 1 Jun 2004 Wile E. Heresiarch deleted "Michael Pennington conspiracy" (listed on copyvio page for 1 month without rewrite)
- 20:09, Jun 1, 2004 Raul654 deleted "Forty-seven Ronin" (content was: '#Redirect [[47 Ronin]]')
- 20:04, 1 Jun 2004 DJ Clayworth deleted "Passadumkeag River" (content was: 'I have no clue what to say about this page except fpr its crap. I need to do a school project and this site is not showing me anything')
- 19:50, 1 Jun 2004 DavidWBrooks deleted "Boyz 'N the Hood" (content was: 'Flim that depicts crimes in low income areas of south central in calfornia')
- 19:46, 1 Jun 2004 Hephaestos deleted "Nina Harper" (content was: '{(msg:delete)}Nina Harper is Sharon Spitz's arch rival on Braceface.')
- 19:44, 1 Jun 2004 UtherSRG deleted "Direct inguinal hernia" (content was: '{(msg:delete)}direct inguinal hernia')
- 19:41, 1 Jun 2004 Hemanshu deleted "User:Hemanshu/monobook.js"
- 19:40, 1 Jun 2004 Maximus Rex deleted "Categories:Differential equations" (content was: '[[Category:Mathematics]]' it supposed to be "[[Category:..." singular, not plural)
- 19:40, 1 Jun 2004 UtherSRG deleted "Lord's Prayer in Adijakot" (content was: '{(msg:delete)}Lord's Prayer 'Our Father' in Adijakot.Pader Neen, soyid hestun na asmanal, behelenutun tin esem,kamanutun ton shahyon, ahaynat ty...')
- 19:39, 1 Jun 2004 UtherSRG deleted "Lord's Prayer in Volapuk" (content was: '{(msg:delete)}Pader neen,soyid hestune na asmanal,behelenutun tin esem, kamanutum ton shahyon,ahaynat tyn tareh jassid na asmanar fojev na erhoda...')
- 19:39, 1 Jun 2004 Meelar deleted "Girthy" (Please don't use Wikipedia to publish dictionary definitions of slang, esp. slang that's an inside joke of you and your housemates. Thanks, Guanaco)
- 19:39, 1 Jun 2004 UtherSRG deleted "Category:Snooker player" (content was: '{(delete)}')
- 19:29, 1 Jun 2004 Angela deleted "Open tuning" (content was: '{(delete)}')
- 19:29, 1 Jun 2004 Adam Bishop deleted "Popple" (content was: 'Popple- the most interesting word in the world! and my favourite')
- 19:28, 1 Jun 2004 Angela deleted "Ingoma" (content was: ' mbnjbjshsndkjfkdjwhy is there nothing under Rwandan music!!!!!!some of us have to do essays ya know!!!')
- 19:28, 1 Jun 2004 Angela deleted "Boonreung Bauchang" (content was: 'died when the snake he was carrying bit him.')
- 19:26, 1 Jun 2004 Hephaestos deleted "Cratylus" (content was: 'This work is available online at [http://classics.mit.edu/Plato/cratylus.html the internet classics archive].')
- 19:16, 1 Jun 2004 Angela deleted "The Bicentennial Man (short story)" (content was: 'This movie was a good movie it was callled bicentinal man and it was was by asimov and turned')
- 19:12, 1 Jun 2004 Angela deleted "Arthur Robert Peter Baden-Powell, 2nd Baron Baden-Powell" (content was: 'soy scouts de canarias grupo 104 10 años en los scouuts fuy tropa scout soy esquter 104 las palmas')
- 19:07, 1 Jun 2004 Maximus Rex deleted "Free-electron laser" (content was: '{(cleanup)}* [http://sbfel3.ucsb.edu/www/vl_fel.html Free Electron Laser] at the [http://www.vlib.org/ The World Wide Web Virtual Library]* [http://...')
- 19:06, 1 Jun 2004 Angela deleted "George Borg Olivier" (content was: '{(msg:delete)}goin to the zoo')
- 19:01, 1 Jun 2004 Ahoerstemeier deleted "Battle of the Somme (1918)" (content was: '== '''Battle of the Somme''' ==')
- 19:00, 1 Jun 2004 Ahoerstemeier deleted "Desenrascanço" (content was: 'vaita foder meu granda paneleiro== Headline text ==[[Image:Example.jpg]]')
- 18:50, 1 Jun 2004 Maximus Rex deleted "Bloc Obrer Camperol" (content was: 'Redirect to Worker and Peaseant Bloc')
- 18:35, 1 Jun 2004 Zanimum deleted "Eric Niu" (content was: '{(msg:delete)}Most importantly his middle name is Pong. And he'll cut ya.')
- 18:34, 1 Jun 2004 Zanimum deleted "Diplomatic opening to China from Nixon on" (content was: 'bitchfuck cat ass')
- 18:30, Jun 1, 2004 Pollinator deleted "Cynthia wong" (content was: 'Most inportantly she is made of candy. Often found looking at film students like they are meat.')
- 18:10, 1 Jun 2004 Tom- deleted "Johann Ambrosius Bach" (content was: 'BlowJob!')
- 18:08, 1 Jun 2004 Tom- deleted "Moral imperative" (content was: 'I really wish that ethics were less debated, considering thatthere is no right or wrong answer to any morally-centered question, since the whole subject of ethics in itself is opinion.')
- 18:06, 1 Jun 2004 Infrogmation deleted "Suomi rock" (content was: 'Finnish gay-rock, quite simply.{(msg:delete)}')
- 18:04, 1 Jun 2004 Mic deleted "Category:Academies" (Role replaced by Category:Learned societies)
- 18:03, 1 Jun 2004 Infrogmation deleted "Explorer 6" (content was: 'also a giant dinosaur!{(msg:delete)}')
- 17:48, 1 Jun 2004 Infrogmation deleted "The Glory and the Dream" (unhelpful sub stub; content was: 'This is a complete Socio-political narrative of US History from 1932-1972, taken largely from primary sources.')
- 17:48, 1 Jun 2004 Infrogmation deleted "Explorer III" (content was: 'A giant dinosaur that consumes the living particles in space.{(msg:delete)}')
- 17:41, 1 Jun 2004 Infrogmation deleted "Talk:Interconnect facility" ("lllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll")
- 17:39, 1 Jun 2004 Infrogmation deleted "Show People" (content was: '{(msg:delete)}I can hear voices in my head.. is that normal????! hehehehehehe')
- 17:39, 1 Jun 2004 Infrogmation deleted "Siebel Si 204" (content was: '{(msg:delete)} This was an experimental aircraft that was really crappy.')
- 17:36, 1 Jun 2004 Infrogmation deleted "Archeocyathids" (content was: 'multi celled organisms that formed at about 600 million years ago')
- 17:36, 1 Jun 2004 Infrogmation deleted "Leviathan (Farscape)" (content was: 'yeah erm leviathan is on FF7 and is the water godhe pwns but is nothing compared to the uber KOTR')
- 17:34, 1 Jun 2004 Infrogmation deleted "Fluoresce" (content was: 'fluoresce- to undergo, produce, or show fluorescence.')
- 17:34, 1 Jun 2004 Infrogmation deleted "Maned Three-toed Sloth" (content was: 'Hello my name is Bill')
- 17:01, 1 Jun 2004 DavidWBrooks deleted "Platysma" (content was: 'you suck')
- 17:01, 1 Jun 2004 DavidWBrooks deleted "Sarah Clarke" (content was: 'nina is the devil')
- 16:59, 1 Jun 2004 DavidWBrooks deleted "Kreski" (content was: 'Matt Kreski is gay')
- 16:59, 1 Jun 2004 DavidWBrooks deleted "Eric Niu" (content was: 'most importantly his middle name is Pong. And he'll cut ya.')
- 16:58, 1 Jun 2004 DavidWBrooks deleted "Nerf" (content was: 'Most importantly 'Nerf' is reported to be a made-up word.')
- 16:58, 1 Jun 2004 DavidWBrooks deleted "Blank page" (content was: ''' ''')
- 16:58, 1 Jun 2004 DavidWBrooks deleted "1221 Amor" (content was: 'love is for ever')
- 16:28, 1 Jun 2004 Meelar deleted "The Strongest" (content was: '{(msg:delete)}Hello there my name is Jessica.... ya im not giving out my real anme in case sum1 is a physco killer!')
- 16:19, 1 Jun 2004 Zanimum restored "Shelia_the_Kangaroo"
- 15:48, 1 Jun 2004 Hemanshu deleted "User:Hemanshu/monobook.js"
- 15:24, 1 Jun 2004 Ahoerstemeier deleted "Rayveness" (content was: '== Headline text ==<nowiki>Insert non-formatted text here</nowiki>--[[User:207.73.135.11|207.73.135.11]] 13:56, 1 Jun 2004 (UTC)--[[User:207.73.135....')
- 15:14, 1 Jun 2004 Ahoerstemeier deleted "Fluidics" (content was: ''''Bold text'''[http://www.example.com link title]<nowiki>Insert non-formatted text here</nowiki><math>Insert formula here</math>')
- 15:14, 1 Jun 2004 Ahoerstemeier deleted "Prospectus request form" (content was: 'I WANT TO GET EDUCATION IN YOUR UNIVERSITY.PLEASE SEND ME ADMISSION DETAILINCLUDIND PROSPECTUSES IFITKHAR HUSSAIN 841/A Q BLOCK FLATS MODEL TOWN ...')
- 15:14, 1 Jun 2004 Hemanshu deleted "User:Hemanshu/monobook.css" (content was: 'a { text-decoration: underline; color: blue; background: none;}#p-logo { display: none }#p-nav { display:none }#p-search { display:no...')
- 15:10, 1 Jun 2004 Ahoerstemeier deleted "Scottish Youth Theatre" (content was: '== Headline text ==WOOOHOO!')
- 15:10, 1 Jun 2004 Ahoerstemeier deleted "Carrie-list Theorem" (content was: 'Coming soon...')
- 14:58, 1 Jun 2004 Ahoerstemeier deleted "Colosuss" (content was a nonsense redirect created by a vandal: '#REDIRECT[[Anal sex]]')
- 14:42, 1 Jun 2004 UtherSRG deleted "Tap dancer" (blatent test)
- 14:40, 1 Jun 2004 UtherSRG deleted "Microsoft Kids" (content was: '{(delete)}------[[User:62.49.236.108|62.49.236.108]] 12:17, 1 Jun 2004 (UTC)<nowiki>Insert non-formatted text here</nowiki>--[[User:62.49.236.108|6...')
- 14:37, 1 Jun 2004 UtherSRG deleted "Nickel Nickel" (content was: '{(msg:delete)}'Pepsi-Cola hits the spot Twelve full ounces, that's a lot Twice as much for a nickle, too Pepsi-Cola is the drink for you.'')
- 14:35, 1 Jun 2004 UtherSRG deleted "Japanese Dictionary" (content was: '{(msg:delete)}')
- 13:24, 1 Jun 2004 Ed Poor deleted "Test redirect" (Experiment by Cecropia for "merged talk pages")
- 12:53, 1 Jun 2004 Ahoerstemeier deleted "U.S. House Permanent Select Committee on Intelligence" (content was: 'I FUCKED YOUR MOMA!!!')
- 12:40, 1 Jun 2004 Angela deleted "Talk:Templatei:Pic of the day" (mispelling (mine))
- 12:24, 1 Jun 2004 Jdforrester restored "June_2004"
- 12:06, 1 Jun 2004 Ahoerstemeier deleted "Douglock" (content were editing experiments)
- 11:44, 1 Jun 2004 Ahoerstemeier deleted "Universities in sweden pursuing programmes in estate management" (content was: '{(delete)}'''universities in sweden pursuing programmes ''in estate management or facility management'''.''--[[User:195.8.26.50|195.8.26.50]] 10:21,...')
- 11:44, 1 Jun 2004 Ahoerstemeier deleted "Continuing Medical Education" (content was: 'CME s in India')
- 11:43, 1 Jun 2004 Ahoerstemeier deleted "Bur Tillstrom" (content was: '[http://www.example.com link title]http://lion.ultinet.net/~kfo/tempo.html The Real World of Kukla, Fran and Ollie')
- 11:42, 1 Jun 2004 Ahoerstemeier deleted "MOS Technologies 8563" (content was: '[http://www.funet.fi/pub/cbm/schematics/computers/c128/manual/36.gif Service Manual C-128/C128D Computer page 36]')
- 11:42, 1 Jun 2004 Ahoerstemeier deleted "Devadasis" (content was: '). If you are here by mistake, just click your browser's back button. Your addition to the encyclopedia will be visible immediately, so if you just want to test how things work, please do that in the sandbox. Please understand that nonsensical submissions will be removed. Thanks!')
- 11:42, 1 Jun 2004 Ahoerstemeier deleted "1874 Canadian election" (content was: '{(delete)}dgdfgfdg')
- 11:41, 1 Jun 2004 Ahoerstemeier deleted "Sir William Muir" (content was: '{(delete)}Muir was a bastard. son of a bitch. A pig. he is in hell right now.')
- 11:40, 1 Jun 2004 Ahoerstemeier deleted "Turanshah" (content was: '{(delete)}Wait, before you delete, I'd love to compliment you on this great site! It has helped me with so many School projects I don't understand. ...')
- 11:39, 1 Jun 2004 Ahoerstemeier deleted "Cosmos 419" (content was: '{(delete)}== Headline text ==FUCK YOU')
- 11:38, 1 Jun 2004 Ahoerstemeier deleted "Purefoods Tender Juicy Hotdogs" (content was: '{(delete)}nnmnmn')
- 11:38, 1 Jun 2004 Ahoerstemeier deleted "Zond 2" (content was: '{(delete)}== Headline text ==Your Gay')
- 11:37, 1 Jun 2004 Ahoerstemeier deleted "Dombey and Son" (content was: 'This is the most stupid book he has ever written. Infact, all his books are stupid!!!!!!!!!!')
- 11:37, 1 Jun 2004 Ahoerstemeier deleted "Pashko Vasa" (content was: '{(delete)}ethnic vlachyou are so funnyhaw do you finde that i am so curious')
- 11:36, 1 Jun 2004 Ahoerstemeier deleted "Gunung Lambak" (content was: '{(delete)}<nowiki>Insert non-formatted text here</nowiki>')
- 11:36, 1 Jun 2004 Ahoerstemeier deleted "Kitten Natividad" (content was: '{(delete)}Yeah Baby the Kitten, now she was a cool cat with be-bap a waddly-daps to match.')
- 11:32, 1 Jun 2004 Hemanshu deleted "User:Hemanshu/monobook.js"
- 11:12, 1 Jun 2004 Finlay McWalter deleted "Talk:River Clyde" (patent nonsense: content was: '<math>(\frac{1}{(\sqrt{n})^2})^{-1}</math>')
- 09:55, 1 Jun 2004 Olivier deleted "First Anniversary of July 1 Rally in Hong Kong" (content was: 'In July 1 2003, a million Hongkongers gathered at [[Victoria Park]] and rally to the central government offices in Central to stop the national secuir...' - content already in "History of Hong Kong")
- 09:46, 1 Jun 2004 Fuzheado deleted "Bits velociraptors" (content was: 'Students of Bits-Pilani Class of 2000')
- 08:38, 1 Jun 2004 Ahoerstemeier deleted "Audio quality" (content was: '{(delete)}zxcvzxcv zxcv zxcxcvxvcbxvbxvbxvc')
- 08:37, 1 Jun 2004 Hemanshu deleted "St. Olmet" (content was: '{(delete)}')
- 08:34, 1 Jun 2004 Gentgeen deleted "Category:Aromatic hydrocarbon" (used singular name instead of plural. content moved to [[Category:Aromatic hydrocarbons]])
- 08:31, 1 Jun 2004 Hadal deleted "Aptenodytes" (content was: '{(delete)}[[Link title]]www.kiss.com')
- 08:05, 1 Jun 2004 Olivier deleted "Radio hosts quit as suppression of mass media, Hong Kong" (content before blanking was: 'Life threats was made to two prominent radio talkshows hosts in Hong Kong in April and May 2004. They quitted the job and left the city. Cheung Kong,...')
- 08:00, 1 Jun 2004 Isomorphic deleted "Ulcinj" (nonsense vandalism)
- 07:39, 1 Jun 2004 Hadal deleted "Indian American" (content was: '{(delete)}need a list of indian americans who are members of the us senate and who are members of the democratic and republic convention committees--...')
- 07:25, 1 Jun 2004 Hadal deleted "Devil dog" (content was: '== Headline text ==SATAN'S DOG!!! IT's SATAN's DOGGIE')
- 07:09, 1 Jun 2004 Maximus Rex deleted "Political rights" (content was: '[[Category: Social Justice]]')
- 07:08, 1 Jun 2004 Maximus Rex deleted "Tehachapi Mountains" (content was: 'over 9,000 kilometers of mountainous terrange.')
- 07:05, 1 Jun 2004 Maximus Rex deleted "Nobski" (content was: 'Nobski is teh Sh!t')
- 07:05, 1 Jun 2004 Maximus Rex deleted "Mother Goose and Grimm" (content was: 'http://www.grimmy.com/welcome.html')
- 06:48, 1 Jun 2004 Angela deleted "Category:Estonian Psycologists" (content was: '{(msg:delete)}' mispelt)
- 06:45, 1 Jun 2004 Angela restored "Category:Psychologists"
- 06:44, 1 Jun 2004 Angela deleted "Category:Psychologists" (temp delete to fix links)
- 06:39, 1 Jun 2004 Angela deleted "Category:Psycologists" (content was: '{(msg:delete)}' mispelt)
- 06:38, 1 Jun 2004 Hadal deleted "Fils" (content was: 'jimmajimma jimma')
- 06:20, 1 Jun 2004 Hadal deleted "Nanotransistor" (junk)
- 06:17, 1 Jun 2004 Maximus Rex deleted "Demodicidosis" (content was: 'Great page to start withhttp://www.emedicine.com/oph/byname/demodicosis.htm')
- 06:15, 1 Jun 2004 Infrogmation deleted "Baycon" (orphan promotional stub; content was: 'Baycon is an annual Science Fiction and Fantasy convention held during Memorial Day weekend at the Doubletree Hotel in San Jose, California.')
- 05:51, 1 Jun 2004 Hadal deleted "Saugeen Shores, Ontario" (content was: 'Lots of good pot')
- 05:44, 1 Jun 2004 Mikkalai deleted "Veche" (wrong redirect, hides missing topic. content before blanking was: '#redirect [[Ting]]')
- 05:34, 1 Jun 2004 Maximus Rex deleted "Tonix" (content was: '{(msg:delete)}Man's name composed by Tonix Yu-peng Luo for himself in about 1996. At that time, he just did it for fun, without anything meaningful.')
- 05:23, 1 Jun 2004 Maximus Rex deleted "Serbian October Revolution" (content was: 'this revolution took place and it was kinda like the reformation but not really at all')
- 05:22, 1 Jun 2004 Infrogmation deleted "Lewis dot notation" (unhelpful sub-stub; content was: 'This depends on the lewis configuration of your particle.AlyYou can find [more]www.cnet.com')
- 05:05, Jun 1, 2004 Merovingian deleted "User:00LuckyBoy00" (created by another user; senseless)
- 05:02, Jun 1, 2004 Merovingian deleted "User:-1, troll" (content was: 'Test CoolickaTelefon bla bla')
- 04:58, 1 Jun 2004 Angela deleted "Templatei:Pic of the day" (wrong title)
- 04:58, 1 Jun 2004 Angela deleted "Template:Pic of the day" (page move)
- 04:58, Jun 1, 2004 Merovingian deleted "User:!T-Rex!" (was vandalized)
- 04:58, 1 Jun 2004 Angela restored "Templatei:Pic_of_the_day"
- 04:57, 1 Jun 2004 Angela deleted "Templatei:Pic of the day" (wrong title)
- 04:56, 1 Jun 2004 Maximus Rex deleted "Minimal message length" (content was: ''The ratio of text to prediction is our measure'gene oldfield artist's statement of the june'04 show at the Pierogi gallery with math covering the wa...')
- 04:56, Jun 1, 2004 Merovingian deleted "User:!BlackFlag!" (was vandalized)
- 04:54, Jun 1, 2004 Dori deleted "Marjeta Zaçe" (content was: 'She was da bomb yo')
- 04:52, 1 Jun 2004 Hadal deleted "Bangko Sentral ng Pilipinas" (content was: '{(msg:delete)}kupal!')
- 04:49, 1 Jun 2004 Hadal deleted "Oban Single Malt" (content was: '{(delete)}drank a whole liter one night at happy hour at the stoueffer rivera bar in chicago...with 2 other guys...proceeded to grab a cab to the ch...')
- 04:49, 1 Jun 2004 Hadal deleted "Rock The Roll" (requested by author; content was: '{(delete)}==Why==Had posted full lyrics for a song here. Copyright violation. Deleted lyrics, so now page is empty.')
- 04:48, 1 Jun 2004 Hadal deleted "I Know You Will" (requested by author; content was: '{(delete)}==Why==Had posted full lyrics for a song here. Copyright violation. Deleted lyrics, so now page is empty.')
- 04:48, 1 Jun 2004 Hadal deleted "United Nations Resolution 37/37" (content was: '{(delete)}what is it please inform. Some people might need to do reports on it.Thank you')
- 04:46, 1 Jun 2004 Hadal deleted "Where You Gonna Run To" (requested by author; content was: '{(delete)}==Why==Had posted full lyrics for a song here. Copyright violation. Deleted lyrics, so now page is empty.')
- 04:46, 1 Jun 2004 Hadal deleted "Hey Everybody" (requested by author; content was: '{(delete)}==Why==Had posted full lyrics for a song here. Copyright violation. Deleted lyrics, so now page is empty.')
- 04:45, 1 Jun 2004 Hadal deleted "Can I Go Now" (requested by author; content was: '{(delete)}==Why==Had posted full lyrics for a song here. Copyright violation. Deleted lyrics, so now page is empty.')
- 04:44, 1 Jun 2004 Hadal deleted "BareNaked" (requested by author; content was: '{(delete)}==Why==Had posted full lyrics for a song here. Copyright violation. Deleted lyrics, so now page is empty.')
- 04:43, 1 Jun 2004 Hadal deleted "Cape Bojador" (content was: '{(msg:delete)}The place where stuff happened.')
- 04:43, 1 Jun 2004 Hadal deleted "Captain Midnight" (content was: '[http://www.signaltonoise.net/library/captmidn.htm The Story Of Captain Midnight]')
- 03:55, 1 Jun 2004 UtherSRG deleted "Crab-eating Macaque" (content was: '#REDIRECT [[Cynomolgus monkey]]')
- 03:54, 1 Jun 2004 UtherSRG deleted "Crab-Eating Macaque" (content was: '#REDIRECT [[Cynomolgus monkey]]')
- 03:53, 1 Jun 2004 Wile E. Heresiarch deleted "Circle Marriage" (speed delete candidates, item 4; orphan, apparent fabrication created by [[User:24.218.52.116]], contribution history shows other fabrication and vanity; no evidence of circulation of term found; original content was "See Group marriage.")
- 03:37, Jun 1, 2004 Sarge Baldy deleted "Categories:Movies" (mistakenly created)
- 03:08, Jun 1, 2004 Ugen64 deleted "Category:WW2 guns" (this is pointless -- see Category:World War 2 guns)
- 02:48, Jun 1, 2004 Merovingian deleted "Augustus Nicholas Burke, (1838 - 1891)" (RFD)
- 02:48, Jun 1, 2004 Merovingian deleted "Thomas Henry Burke, (1829 - 1882)" (RFD)
- 02:47, Jun 1, 2004 Merovingian deleted "Shakespearean Long Poetry" (RFD)
- 02:46, Jun 1, 2004 Merovingian deleted "James W. Marshall" (RFD)
- 02:40, Jun 1, 2004 Merovingian deleted "Sir Clive Woodward" (RFD)
- 02:39, 1 Jun 2004 Cecropia deleted "What role did the people of paris play in the french revolution?" (content was: 'lopo')
- 02:39, Jun 1, 2004 Merovingian deleted "Real (Disambiguation)" (RFD)
- 02:38, 1 Jun 2004 Cecropia deleted "What role did the people of paris play in the french revolution?" (content was: 'lopo')
- 02:36, 1 Jun 2004 Maximus Rex deleted "Logical errors" (content was: 'but i absolutely love oscar... he is sooo beautiful!!')
- 02:33, 1 Jun 2004 Angela deleted "TAD" (content was: 'TAD=Turn-around DocumentA record of the event and as a reference material.')
- 02:31, 1 Jun 2004 Maximus Rex deleted "Logical errors" (content was: 'a logical error is when natalia is so dumb she goes out with Oscar the toad')
- 02:25, 1 Jun 2004 Guanaco deleted "Don Chipp" (content was: 'hjnkjh')
- 02:20, 1 Jun 2004 Hephaestos deleted "You (Song By Jennifer Love Hewitt)" (content was: '{(delete)}==Why==Had posted full lyrics for a song here. Copyright violation. Deleted lyrics, so now page is empty.')
- 02:18, 1 Jun 2004 Hephaestos deleted "Dig Dug" (content was: '== Dig Dug ==Dig Dug is an awesome game for the atari where you cause animals to explode with an air pump. Sometimes you can insert the pump into th...')
- 02:01, 1 Jun 2004 Maximus Rex deleted "Test" (content was: '= Test =This page has one sole purpose, and that would be to be a test. Please dispose of this page, as it has no use')
- 01:35, Jun 1, 2004 Merovingian deleted "Kevin Rose" (content was: 'Kevin Rose is seen on TechTV quite often and is a wannabe hacker. You can also find him on an episode of the horrible net show type thing know as The ...')
- 01:34, Jun 1, 2004 Merovingian deleted "You stink" (content was: '{(delete)}You stink.')
- 01:34, 1 Jun 2004 Guanaco deleted "FPT" (disambig w/ just a broken link)
- 01:34, 1 Jun 2004 Guanaco deleted "FPR" (disambig w/ just a broken link)
- 01:33, 1 Jun 2004 Guanaco deleted "EGR" (disambig w/ just a broken link)
- 01:30, Jun 1, 2004 Merovingian deleted "Surface Structure" (content was: '{(delete)}john kerry will bring this country down!!!')
- 01:30, 1 Jun 2004 Finlay McWalter deleted "Subbot" (content was: '{(delete)}')
- 01:25, 1 Jun 2004 Angela deleted "Wikipedia:Sandbox/TestingMdash—TestingMdash" (content was: '{(msg:speedydelete)}This is a test of the emergency mdash page title creation system. This is only a test.')
- 01:18, 1 Jun 2004 Guanaco deleted "EFI" (disambig with only a broken link)
- 01:18, 1 Jun 2004 Guanaco deleted "EBD" (disambig with only a broken link)
- 01:18, 1 Jun 2004 Maximus Rex deleted "You stink" (content was: 'You stink.')
- 01:17, 1 Jun 2004 Guanaco deleted "BOV" (disambig with just a broken link)
- 01:16, 1 Jun 2004 Guanaco deleted "AMM" (disambig w/ only one link, and the link is broken)
- 01:14, 1 Jun 2004 Guanaco deleted "Reason To Believe (fanzine)" (content was: '{(msg:vfd)}[[Hardcore punk]] [[fanzine]] from the UK. Covers the DIY music scene, politics and music.')
- 01:14, 1 Jun 2004 Guanaco deleted "Fracture (fanzine)" (content was: '{(msg:vfd)}Now defunct [[punk rock]] free fanzine from the UK.')
- 01:13, 1 Jun 2004 Guanaco deleted "Murder Contest" (content was: '{(msg:vfd)}[[Hardcore punk]] [[fanzine]] from [[Leeds]], [[England]].')
- 01:09, 1 Jun 2004 Guanaco deleted "3.5G" (content was: '[[HSDPA|High Speed Downlink Packet Access]] is being referred to as '''3.5G'''.')
- 01:09, 1 Jun 2004 Guanaco deleted "2. Online functions" (content was: '{(msg:vfd)}Back to [http://en.wikipedia.org/wiki/Translation_memory Translation Memory]' (not really on VfD))
- 01:08, 1 Jun 2004 Guanaco deleted "2. Main Obstacles" (content was: '[[Back]] to [http://en.wikipedia.org/wiki/Translation_memory Translation Memory]')
- 00:51, 1 Jun 2004 Brion VIBBER deleted "Bogus title KU:Faculty of Natural Science" (content was: '#REDIRECT [[University_of_Copenhagen_Faculty_of_Natural_Science]]')
- 00:50, 1 Jun 2004 Guanaco deleted "Category:Food" (orphaned - contents moved to [[Category:Food and drink]])
- 00:45, 1 Jun 2004 UtherSRG deleted "Golden Monkey" (content was: '#redirect [[Blue Monkey]]')
- 00:32, 1 Jun 2004 Docu deleted "Category:List of musicians" (del category I just created)
- 00:26, 1 Jun 2004 Timwi deleted "Category:Austro-Asiatic languages" (moved)
- 00:24, 1 Jun 2004 Francs2000 deleted "Warlock.jpg" (content was: '[[Image:Warlock.jpg]]')
- 00:22, 1 Jun 2004 Francs2000 deleted "Carolina Life Insurance Company" (content was: 'hdgdghdhhdfhdghdghdghdhdhgdhdfhgddhg')
- 00:12, 1 Jun 2004 Guanaco deleted "DJ Encore" (content was: '{{delete}}Smash song 'I see right through to you'')
- 00:12, 1 Jun 2004 Guanaco deleted "Monica Gomez" (content was: '{{delete}}Hi my name is monica!!i go to hazelbrooke middle schoolmy friend leh is over right now,shes kinda weirdya'life sucks right now becaus...')
- 00:08, 1 Jun 2004 Guanaco deleted "User:ScudLee" (content was: '.')